Potassium Channel Kv3.1 Antibody - Azide and BSA Free Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Potassium Channel Kv3.1 (NP_004967.1). MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KCNC1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:100 - 1:500
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for Potassium Channel Kv3.1 Antibody - Azide and BSA Free
Background
Voltage-gated K+ channels are important determinants of neuronal membrane excitability. Moreover, differences in K+ channel expression patterns and densities contribute to the variations in action potential waveforms and repetitive firing patterns evident in different neuronal cell types (Maletic-Savatic et al., 1995; Pongs, 1999; Blaine and Ribera, 1998; Burger and Ribera, 1996). The Kv3.1 potassium channel is expressed at high levels in neurons that characteristically fire rapid trains of action potentials (Gan et al., 1999). Particularly high levels of this channel are found in neurons of the auditory brainstem. These neurons appear to participate in neural circuits that determine the intensity and timing of auditory stimuli and use this information to determine the location of sounds in space (von Hehn et al., 2004).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rb
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Mu
Applications: IHC, IHC-P, WB
Species: Fe, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Potassium Channel Kv3.1 Antibody (NBP3-16151) (0)
There are no publications for Potassium Channel Kv3.1 Antibody (NBP3-16151).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Potassium Channel Kv3.1 Antibody (NBP3-16151) (0)
There are no reviews for Potassium Channel Kv3.1 Antibody (NBP3-16151).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Potassium Channel Kv3.1 Antibody (NBP3-16151) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Potassium Channel Kv3.1 Products
Research Areas for Potassium Channel Kv3.1 Antibody (NBP3-16151)
Find related products by research area.
|
Blogs on Potassium Channel Kv3.1