Porimin Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Porimin Antibody [NBP2-68797] - Staining of human cell line RH-30 shows localization to the Golgi apparatus & vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Porimin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ANIENSGLPHNSSANSTETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM123
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  Porimin Recombinant Protein Antigen (NBP2-68797PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Porimin Antibody - BSA Free

• KCT3
• KCT-3
• KCT3keratinocytes associated transmembrane protein 3
• Keratinocytes-associated transmembrane protein 3
• Porimin
• PORIMINporimin
• pro oncosis receptor inducing membrane injury
• Pro-oncosis receptor inducing membrane injury
• serine/threonine-rich receptor
• TMEM123
• transmembrane protein 123PORMIN

Background

Porimin was identified by a monoclonal antibody developed by immunizing mice with apoptotic cells. One of these antibodies, designated anti-Porimin (for pro-oncosis receptor inducing membrane injury), was found to directly induce a unique type of cell death in Jurkat cells by binding to a 110-kDa cell surface receptor on Jurkat cells. Anti-Porimin-mediated cell death was preceded by cell aggregation, formation of plasma membrane pores, and the appearance of membrane blebs. More important, these cells show neither DNA fragmentation nor apoptotic bodies, but display lethal damage of the cell membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMEM123