POP1 Antibody - BSA Free

Images

 
Western Blot: POP1 Antibody [NBP2-93628] - Analysis of extracts of various cell lines, using POP1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per ...read more

Product Details

Summary
Reactivity Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

POP1 Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human POP1 (NP_055844.2). MSNAKERKHAKKMRNQPTNVTLSSGFVADRGVKHHSGGEKPFQAQKQEPHPGTSRQRQTRVNPHSLPDPEVNEQSSSKGMFRKKGGWKAGPEGTSQEIPKYITASTFAQARAAEISAMLKAVTQKSSNSLVFQTLPRHMRRRAMSHNVKRLPRRLQEIAQKEAEKAVHQKKEHSKNKCHKARRCHMNRTLEFNRRQKKNIWLETHIWHAK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:200-1:2000
Theoretical MW
114 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for POP1 Antibody - BSA Free

  • EC 3.1.26.5
  • hPOP1
  • KIAA0061
  • MGC17365
  • processing of precursor 1, ribonuclease P/MRP subunit (S. cerevisiae)
  • processing of precursors 1
  • ribonucleases P/MRP protein subunit POP1

Background

POP1 (processing of precursor 1) is a subunit of both the ribonuclease P and RNase MRP holoenzymes which are involved in 5'-end maturation of precursor tRNAs (pre-tRNAs). POP1 has been found to be an autoantigen in patients suffering from connective tissue diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for POP1 Antibody (NBP2-93628) (0)

There are no publications for POP1 Antibody (NBP2-93628).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POP1 Antibody (NBP2-93628) (0)

There are no reviews for POP1 Antibody (NBP2-93628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POP1 Antibody (NBP2-93628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POP1 Products

Research Areas for POP1 Antibody (NBP2-93628)

Find related products by research area.

Blogs on POP1

There are no specific blogs for POP1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POP1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol POP1