Recombinant Human POLR3D Protein

Images

 
SDS-Page: Recombinant Human POLR3D Protein [H00000661-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human POLR3D Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 296-395 of Human POLR3D

Source: Wheat Germ

Amino Acid Sequence: GQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
POLR3D
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human POLR3D Protein

  • BN51 (BHK21) temperature sensitivity complementing
  • BN51
  • BN51TDNA-directed RNA polymerase III 47 kDa polypeptide
  • DNA-directed RNA polymerase III subunit D
  • DNA-directed RNA polymerase III subunit RPC4
  • polymerase (RNA) III (DNA directed) polypeptide D, 44kDa
  • Protein BN51
  • RNA polymerase III 47 kDa subunit
  • RNA polymerase III subunit C4
  • RPC4
  • RPC53 homolog
  • temperature sensitive complementation, cell cycle specific, tsBN51
  • TSBN51RPC53

Background

POLR3D - polymerase (RNA) III (DNA directed) polypeptide D, 44kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-80815
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84628
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-84621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00009533-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01265
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-89922
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47329
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87786
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83204
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88973
Species: Hu
Applications: IHC, IHC-P
NBP1-87113
Species: Hu, Mu, Rt, Dr
Applications: WB, IHC, IHC-P

Publications for POLR3D Partial Recombinant Protein (H00000661-Q01) (0)

There are no publications for POLR3D Partial Recombinant Protein (H00000661-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR3D Partial Recombinant Protein (H00000661-Q01) (0)

There are no reviews for POLR3D Partial Recombinant Protein (H00000661-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POLR3D Partial Recombinant Protein (H00000661-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POLR3D Products

Bioinformatics Tool for POLR3D Partial Recombinant Protein (H00000661-Q01)

Discover related pathways, diseases and genes to POLR3D Partial Recombinant Protein (H00000661-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for POLR3D Partial Recombinant Protein (H00000661-Q01)

View related products by pathway.

Blogs on POLR3D

There are no specific blogs for POLR3D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
POLR3D Antibody
NBP2-49530

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human POLR3D Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR3D