PMCH Antibody

Product Discontinued

PMCH Antibody Summary

• Immunogen: Synthetic peptide directed towards the N terminal of human PMCHThe immunogen for this antibody is PMCH. Peptide sequence RLGKGFQKEDTAEKSVIAPSLEQYKNDESSFMNEEENKVSKNTGSKHNFL. The peptide sequence for this immunogen was taken from within the described region.
• Predicted Species: Bovine (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PMCH
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:1000
• Application Notes: This is a rabbit polyclonal antibody against PMCH and was validated on Western blot.
• Theoretical MW: 19 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PMCH Antibody

• MCHpro-MCH
• pro-melanin-concentrating hormone

Background

MCH may act as a neurotransmitter or neuromodulator in a broad array of neuronal functions directed toward the regulation of goal-directed behavior, such as food intake, and general arousal. May also have a role in spermatocyte differentiation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PMCH
• Uniprot:
  • NP_002665(Human)