Recombinant Human PLK2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PLK2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 585-685 of Human PLK2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DGGDLPSVTDIRRPRLYLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTLLMSGCSSELKNRMEYALNMLLQRCN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PLK2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00010769-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PLK2 Protein

  • EC 2.7.11
  • PLK-2
  • polo-like kinase 2EC 2.7.11.21
  • serine/threonine-protein kinase PLK2
  • Serine/threonine-protein kinase SNK
  • Serum-inducible kinase
  • SNKpolo-like kinase 2 (Drosophila)

Background

PLK2 - polo-like kinase 2 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP2-32530
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33402
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB7557
Species: Hu
Applications: WB, IHC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90482
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-80999
Species: Hu
Applications: IHC, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF

Publications for PLK2 Partial Recombinant Protein (H00010769-Q01)(1)

Reviews for PLK2 Partial Recombinant Protein (H00010769-Q01) (0)

There are no reviews for PLK2 Partial Recombinant Protein (H00010769-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLK2 Partial Recombinant Protein (H00010769-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLK2 Products

Bioinformatics Tool for PLK2 Partial Recombinant Protein (H00010769-Q01)

Discover related pathways, diseases and genes to PLK2 Partial Recombinant Protein (H00010769-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLK2 Partial Recombinant Protein (H00010769-Q01)

Discover more about diseases related to PLK2 Partial Recombinant Protein (H00010769-Q01).
 

Pathways for PLK2 Partial Recombinant Protein (H00010769-Q01)

View related products by pathway.

PTMs for PLK2 Partial Recombinant Protein (H00010769-Q01)

Learn more about PTMs related to PLK2 Partial Recombinant Protein (H00010769-Q01).
 

Research Areas for PLK2 Partial Recombinant Protein (H00010769-Q01)

Find related products by research area.

Blogs on PLK2

There are no specific blogs for PLK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF
PLK2 Antibody
NBP2-15078

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PLK2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLK2