Plexin B3 Antibody - BSA Free

Western Blot: Plexin B3 Antibody [NBP3-09457] - Western blot analysis of Plexin B3 in Jurkat Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Plexin B3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Plexin B3 Antibody - BSA Free (NBP3-09457) is a polyclonal antibody validated for use in WB. Anti-Plexin B3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human Plexin B3 (BAH12215). Peptide sequence DYRTYAERAFFPGHGGCPLQPKPEGPGEDGHCATVRQGLTQLSNLLNSKL
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLXNB3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 171 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Plexin B3 Antibody - BSA Free

• PLEXB3
• Plexin B3
• plexin-B3
• PLEXR
• PLXN6
• PLXNB3

Background

The protein encoded by the Plexin B3 gene is a member of the plexin family. It functions as a receptor for semaphorin 5A, and plays a role in axon guidance, invasive growth and cell migration. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Plexin B3 Antibody (NBP3-09457)(1)

Publication using NBP3-09457

• Zuo Q, Yang Y, Lyu Y, Yang C, Chen C, Salman S, Huang T, Wicks E, Jackson W, Datan E, Qin W, Semenza G Plexin-B3 expression stimulates MET signaling, breast cancer stem cell specification, and lung metastasis. Cell Rep, 2023-02-28;42(3):112164. 2023-02-28 [PMID: 36857181]

Bioinformatics

• Gene Symbol: PLXNB3