PLEKHO2 Antibody

Immunocytochemistry/Immunofluorescence: PLEKHO2 Antibody [NBP1-84101] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.

Immunohistochemistry-Paraffin: PLEKHO2 Antibody [NBP1-84101] - Staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp and white pulp.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PLEKHO2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SVLPDKLKVSWENPSPQEAPAAESAEPSQAPCSETSEAAPREGGKPPTPPPKILSEKLKASMGEMQASGPPAPGTVQVSVNGMDD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLEKHO2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PLEKHO2 Protein (NBP1-84101PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PLEKHO2 Antibody

• DKFZp761K2312
• FLJ38884
• PH domain-containing family O member 2
• PH domain-containing family Q member 1
• PH domain-containing protein
• pleckstrin homology domain containing, family O member 2
• pleckstrin homology domain containing, family Q member 1
• pleckstrin homology domain-containing family O member 2
• Pleckstrin homology domain-containing family Q member 1
• PLEKHQ1
• PP1628
• pp9099

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLEKHO2