PLEKHO2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PLEKHO2 Antibody [NBP1-84101] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: PLEKHO2 Antibody [NBP1-84101] - Staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp and white pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLEKHO2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVLPDKLKVSWENPSPQEAPAAESAEPSQAPCSETSEAAPREGGKPPTPPPKILSEKLKASMGEMQASGPPAPGTVQVSVNGMDD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLEKHO2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PLEKHO2 Protein (NBP1-84101PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLEKHO2 Antibody

  • DKFZp761K2312
  • FLJ38884
  • PH domain-containing family O member 2
  • PH domain-containing family Q member 1
  • PH domain-containing protein
  • pleckstrin homology domain containing, family O member 2
  • pleckstrin homology domain containing, family Q member 1
  • pleckstrin homology domain-containing family O member 2
  • Pleckstrin homology domain-containing family Q member 1
  • PLEKHQ1
  • PP1628
  • pp9099

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-28489
Species: Rt
Applications: WB, PEP-ELISA
NB100-41395
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP2-15454
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87832
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57829
Species: Hu
Applications: ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF5038
Species: Hu, Mu
Applications: WB
NBP1-82291
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81024
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84101
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PLEKHO2 Antibody (NBP1-84101) (0)

There are no publications for PLEKHO2 Antibody (NBP1-84101).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLEKHO2 Antibody (NBP1-84101) (0)

There are no reviews for PLEKHO2 Antibody (NBP1-84101). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PLEKHO2 Antibody (NBP1-84101) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLEKHO2 Products

Bioinformatics Tool for PLEKHO2 Antibody (NBP1-84101)

Discover related pathways, diseases and genes to PLEKHO2 Antibody (NBP1-84101). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PLEKHO2

There are no specific blogs for PLEKHO2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLEKHO2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEKHO2