PLC-beta 3 Antibody (4C0Z7)

Western Blot: PLC-beta 3 Antibody (4C0Z7) [NBP3-15885] - Western blot analysis of extracts of various cell lines, using PLC beta 3 (PLC-beta 3) Rabbit mAb (NBP3-15885) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

• Reactivity: Hu
• Applications: WB
• Clone: 4C0Z7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PLC-beta 3 Antibody (4C0Z7) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human PLC beta 3 (PLC-beta 3) (Q01970). RKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSIRRLEEAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLG
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PLCB3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PLC-beta 3 Antibody (4C0Z7)

• 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-3
• EC 3.1.4.11
• FLJ37084
• Phosphoinositide phospholipase C-beta-3
• phospholipase C, beta 3 (phosphatidylinositol-specific)
• Phospholipase C-beta-3
• PLC beta 3
• PLCB3
• PLCbeta 3
• PLC-beta 3
• PLC-beta-3

Background

Phosphoinositide-specific phospholipase C (PLC) plays a critical role in the initiation of receptor mediated signal transduction through the generation of the two second messengers, inositol 1, 4, 5-triphosphate and diacylglycerol from phosphatidylinositol 4, 5 bisphosphate. A total of eight mammalian PLC isozymes have been described (PLC beta1, PLC beta2, PLC beta3, PLC beta4, PLC gamma1, PLC gamma2, PLC delta1 and PLC delta2) with molecular weights ranging from 85 to 150 kDa. The gamma-type enzymes are unique in that they contain SH2 and SH3 domains. Moreover, the two gamma-type enzymes, but not the beta and delta isozymes, are subject to activation by a number of protein tyrosine kinases which associate with their SH2 domains and induce their activation by phosphoryation. In contrast, activation of PLC beta1, PLC beta2 and PLC beta3 is mediated by the alpha subunits of the Gq class of heterotrimeric G proteins and by certain betagamma G protein subunits. The regulatory mechanisms for PLC delta1 and PLC delta2 are as yet not resolved.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLCB3