Plasminogen Antibody

Immunohistochemistry: Plasminogen Antibody [NBP2-48919] - Staining of human colon shows positivity in plasma.

Product Discontinued

Plasminogen Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLG
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Plasminogen Antibody

• DKFZp779M0222
• EC 3.4.21
• EC 3.4.21.7
• plasmin
• Plasminogen
• Plg

Background

Plasminogen is a plasma protein synthesised mostly in the liver. Plasma concentration is usually in the range of 70 to 200mg/L. Plasminogen is activated by tissue plasminogen activator, urokinase and streptokinase, to form plasmin. Activation results from the cleavage and release of the preactivation peptide. Angiostatin, an internal fragment of plasminogen, is a potent inhibitor of angiogenesis, which selectively inhibits endothelial cell proliferation. Angiostatin potently inhibits tumor growth and can maintain metastatic and primary tumors in a dormant state. It is defined by a balance of proliferation and apoptosis of the tumor cells and is composed of plasminogen first four cringle structures. This molecule is generated by proteolytic cleavage of plasminogen.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLG