We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Plakophilin 4 Recombinant Protein Antigen

Images

 
There are currently no images for Plakophilin 4 Recombinant Protein Antigen (NBP2-55977PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Plakophilin 4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Plakophilin 4.

Source: E. coli

Amino Acid Sequence: SYSDSGYQEAGSFHNSQNVSKADNRQQHSFIGSTNNHVVRNSRAEGQTLVQPSVANRAMRRVSSVPSRAQSPSYVISTGVSPSR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PKP4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55977.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Plakophilin 4 Recombinant Protein Antigen

  • catenin 4
  • FLJ42243
  • p0071FLJ31261
  • plakophilin 4
  • plakophilin-4

Background

Plakophilin 4, also known by its gene name PKP4, has multiple transcript variants, however only two have been fully characterized. Isoform 1 has 1,192 amino acids and is approximately 132 kDa and the shorter 1,149 amino acid long isoform is approximately 127 kDa. Plakophilin 4 is a member of the Beta Catenin family and the Plakophilin subfamily of Armadillo-like proteins. Plakophilin 4 regulates Rho activity during cytokinesis and may be implicated in the regulation of junctional plaques. Current research on Plakophilin 4 is being performed relating to several diseases and disorders including Alzheimer's Disease, schizophrenia, renal cell carcinoma and cardiomyopathy. PKP4 interacts with Presenilin 1, Erbin, OSGEP, Desmoplakin and GABARAP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-14119
Species: Hu
Applications: IHC,  IHC-P
NBP2-48836
Species: Hu
Applications: IHC,  IHC-P
NB100-79781
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP3-16628
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-92192
Species: Hu, Mu, Rt
Applications: ICC/IF,  IHC-P, WB
NB100-74513
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP2-38999
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86078
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00001501-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
1129-ER
Species: Hu
Applications: BA
NBP1-90042
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-92546
Species: Hu, Mu, Rt
Applications: ELISA, WB
MAB7670
Species: Hu
Applications: ICC, WB
H00055835-M02
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
7754-BH/CF
Species: Hu
Applications: BA
NBP2-55977PEP
Species: Hu
Applications: AC

Publications for Plakophilin 4 Recombinant Protein Antigen (NBP2-55977PEP) (0)

There are no publications for Plakophilin 4 Recombinant Protein Antigen (NBP2-55977PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plakophilin 4 Recombinant Protein Antigen (NBP2-55977PEP) (0)

There are no reviews for Plakophilin 4 Recombinant Protein Antigen (NBP2-55977PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Plakophilin 4 Recombinant Protein Antigen (NBP2-55977PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Plakophilin 4 Products

Blogs on Plakophilin 4

There are no specific blogs for Plakophilin 4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Plakophilin 4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PKP4