Plakophilin 4 Antibody (1B11)

Images

 
Sandwich ELISA: Plakophilin 4 Antibody (1B11) [H00008502-M02] - Detection limit for recombinant GST tagged PKP4 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Plakophilin 4 Antibody (1B11) Summary

Immunogen
PKP4 (NP_001005476, 12 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQRLTRELEVERQIVASQLERCRLGAESPSIASTSSTEKSFPWRSTDVPNTGVSKPRVSDAVQ
Specificity
PKP4 (1B11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PKP4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Plakophilin 4 Antibody (1B11)

  • catenin 4
  • FLJ42243
  • p0071FLJ31261
  • plakophilin 4
  • plakophilin-4

Background

Armadillo-like proteins are characterized by a series of armadillo repeats, first defined in the Drosophila 'armadillo' gene product, that are typically 42 to 45 amino acids in length. These proteins can be divided into subfamilies based on their number of repeats, their overall sequence similarity, and the dispersion of the repeats throughout their sequences. Members of the p120(ctn)/plakophilin subfamily of Armadillo-like proteins, including CTNND1, CTNND2, PKP1, PKP2, PKP4, and ARVCF. PKP4 may be a component of desmosomal plaque and other adhesion plaques and is thought to be involved in regulating junctional plaque organization and cadherin function. Multiple transcript variants have been found for this gene, but the full-length nature of only two of them have been described so far. These two variants encode distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-59109
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-38999
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001501-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
46780002
Species: Hu
Applications: ELISA
MAB7670
Species: Hu
Applications: WB, ICC
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP

Publications for Plakophilin 4 Antibody (H00008502-M02) (0)

There are no publications for Plakophilin 4 Antibody (H00008502-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plakophilin 4 Antibody (H00008502-M02) (0)

There are no reviews for Plakophilin 4 Antibody (H00008502-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Plakophilin 4 Antibody (H00008502-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Plakophilin 4 Products

Bioinformatics Tool for Plakophilin 4 Antibody (H00008502-M02)

Discover related pathways, diseases and genes to Plakophilin 4 Antibody (H00008502-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plakophilin 4 Antibody (H00008502-M02)

Discover more about diseases related to Plakophilin 4 Antibody (H00008502-M02).
 

Pathways for Plakophilin 4 Antibody (H00008502-M02)

View related products by pathway.

PTMs for Plakophilin 4 Antibody (H00008502-M02)

Learn more about PTMs related to Plakophilin 4 Antibody (H00008502-M02).

Blogs on Plakophilin 4

There are no specific blogs for Plakophilin 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Plakophilin 4 Antibody (1B11) and receive a gift card or discount.

Bioinformatics

Gene Symbol PKP4
Entrez
OMIM
Uniprot