Home » PLA2G16/HRASLS3 » HRASLS3 Research Products » PLA2G16/HRASLS3 Antibody

PLA2G16/HRASLS3 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PLA2G16/HRASLS3 Antibody [H00011145-B01P] - Analysis of HRASLS3 expression in human placenta.
Western Blot: PLA2G16/HRASLS3 Antibody [H00011145-B01P] - Analysis of HRASLS3 expression in human placenta.
Immunocytochemistry/ Immunofluorescence: PLA2G16/HRASLS3 Antibody [H00011145-B01P] - Analysis of purified antibody to HRASLS3 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: PLA2G16/HRASLS3 Antibody [H00011145-B01P] - Analysis of PLA2G16 expression in transfected 293T cell line by PLA2G16 polyclonal antibody. Lane 1: HRASLS3 transfected lysate(17.82 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PLA2G16/HRASLS3 Antibody Summary

Immunogen
HRASLS3 (AAH01387.1, 1 a.a. - 162 a.a.) full-length human protein. MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
Specificity
HRASLS3 - HRAS-like suppressor 3,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PLA2G16
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PLA2G16/HRASLS3 Antibody

  • Adipose-specific phospholipase A2
  • AdPLA
  • AdPLAHRASLS3
  • EC 3.1.1.4
  • group XVI phospholipase A2
  • HRAS-like suppressor 3Ca-independent phospholipase A1/2
  • HRASLS3
  • HREV107
  • H-REV107-1
  • HREV107-3adipose-specific PLA2
  • HREV107H-rev 107 protein homolog
  • MGC118754
  • phospholipase A2, group XVI
  • PLA2G16
  • Renal carcinoma antigen NY-REN-65

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RARRES3 Antibody
AF6139
RARRES3 was detected in immersion fixed Raji human Burkitt's lymphoma cell line using Human RARRES3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6139) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Species: Hu
Applications: ICC
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(14 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
LRAT Antibody
(M34-P1F10)
NBP2-50444
Western Blot: LRAT Antibody (M34-P1F10) [NBP2-50444] - Shows detection of LRAT in an overexpression lysate.
Immunocytochemistry/Immunofluorescence: LRAT Antibody (M34-P1F10) [NBP2-50444]
Immunohistochemistry: LRAT Antibody (M34-P1F10) [NBP2-50444]
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
HRAS Antibody
(OTI1D9)
NBP2-45745
Western Blot: HRAS Antibody (OTI1D9) [NBP2-45745] - Analysis of extracts (35ug) from 9 different cell lines (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: HRAS Antibody (OTI1D9) [NBP2-45745] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Western Blot: HRAS Antibody (OTI1D9) [NBP2-45745] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY vH RAS.
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IF
Phospholipase B1
Antibody
H00151056-B01P
Western Blot: Phospholipase B1 Antibody [H00151056-B01P] - Analysis of PLB1 expression in transfected 293T cell line by PLB1 polyclonal antibody. Lane 1: PLB1 transfected lysate(46.53 KDa). Lane 2: Non-transfected lysate.
(1 Publication)
Species: Hu, Mu
Applications: WB
PEDFR/PNPLA2/ATGL
Antibody
NB110-41536
Western Blot: ATGL Antibody [NB110-41536] - Detection of ATGL in human adipose tissue lysate.
Immunocytochemistry/Immunofluorescence: ATGL Antibody [NB110-41536] - ATGL antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF
PRRT2 Antibody
NBP2-82026
Western Blot: PRRT2 Antibody [NBP2-82026] - Analysis of PRRT2 in mouse brain tissue lysate with PRRT2 antibody at 1 ug/ml.
Immunocytochemistry/Immunofluorescence: PRRT2 Antibody [NBP2-82026] - Immunofluorescence of PRRT2 in rat brain tissue with PRRT2 antibody at 20 ug/ml.
Immunohistochemistry: PRRT2 Antibody [NBP2-82026] - Immunohistochemistry of PRRT2 in rat brain tissue with PRRT2 antibody at 2.5 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Leptin/OB [HRP]
DLP00
(1 Review)
(99 Publications)
Species: Hu
PPP2R4 Antibody
(4D9)
NBP2-37530
Western Blot: PPP2R4 Antibody (4D9) [NBP2-37530] - Western blot analysis using PPP2R4 mAb against human PPP2R4 (AA: 1-154) recombinant protein. (Expected MW is 41 kDa)
Immunocytochemistry/Immunofluorescence: PPP2R4 Antibody (4D9) [NBP2-37530] - Immunofluorescence analysis of Hela cells using PPP2R4 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: PPP2R4 Antibody (4D9) [NBP2-37530] - Immunohistochemical analysis of paraffin-embedded cervical cancer tissues using PPP2R4 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
PPAR gamma/NR1C3
Antibody
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(2 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
PTGER3 Antibody
NLS975
Immunohistochemistry-Paraffin: PTGER3 Antibody [NLS975] - Anti-PTGER3 / EP3 antibody IHC of human Breast, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: PTGER3 Antibody [NLS975] - Analysis of anti-PTGER3 / EP3 antibody with human brain, glioblastoma.
Immunohistochemistry-Paraffin: PTGER3 Antibody [NLS975] - Anti-PTGER3 / EP3 antibody IHC of human brain, hippocampus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Hu, Bt, Pm, Pm
Applications: IHC, IHC-P
Hormone-sensitive
Lipase/HSL Antibody
NB110-37253
Western Blot: HSL Antibody [NB110-37253] - Detection of HSL using NB110-37253. Lane 1: Liver extract (negative control) Lane 2: Fat extract (10ug) (positive sample).
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB
PLA2G1B Antibody
(630823)
MAB5018
Western blot shows lysates of human pancreas tissue. PVDF Membrane was probed with 2 µg/mL of Human PLA2G1B Monoclonal Antibody (Catalog # MAB5018) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for PLA2G1B at approximately 17 kDa (as indicated). This experiment was conducted under non-reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB, IP
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Cyclin A1 Antibody
NBP1-02902
Western Blot: Cyclin A1 Antibody [NBP1-02902] - Cyclin A1 western with U2OS cells. Image from verified customer review.
Immunohistochemistry-Paraffin: Cyclin A1 Antibody [NBP1-02902] - Human testis after heat-induced antigen retrieval. Antibody dilution 1:500.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
IRF1 Antibody
AF4715
Western blot shows lysates of NIH-3T3 mouse embryonic fibroblast cell line. Gels were loaded with 30 μg of whole cell lysate (WCL), 20 μg of cytoplasmic (Cyto), and 10 μg of nuclear extracts (Nuc). PVDF membrane was probed with 1 µg/mL Mouse IRF1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4715) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band for IRF1 was detected at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(1 Publication)
Species: Mu
Applications: WB
PCNA Antibody
(PC10)
NB500-106
Western Blot: PCNA Antibody (PC10) [NB500-106] - Western blot of PCNA levels across different stages of the cell cycle. U-2 OS cells were synchronised at G1/S with 2 mM thymidine an released for 10 hours for G2/M or re-arrested in G2 for extended duration with 10uM RO-3306. Antibody at 1:2000. WB image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - Development of the germinal zones in the tree shrew neocortex. Immunofluorescence for PCNA (yellow) and DAPI staining (blue) on 30 um-cryosections of E32-P1 tree shrew neocortex. The top margin of the image corresponds to the transition zone SVZ/intermediate zone. Scale bars, 50 um. VZ, ventricular zone; SVZ, subventricular zone; iSVZ, inner SVZ; oSVZ, outer SVZ. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fnana.2018.00029/full), licensed under a CC-BY licence.
Immunohistochemistry: PCNA Antibody (PC10) [NB500-106] - Analysis of PCNA in mouse cornea. Image courtesy of product review by Bo-Yie Chen.
(5 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl

Publications for PLA2G16/HRASLS3 Antibody (H00011145-B01P) (0)

There are no publications for PLA2G16/HRASLS3 Antibody (H00011145-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLA2G16/HRASLS3 Antibody (H00011145-B01P) (0)

There are no reviews for PLA2G16/HRASLS3 Antibody (H00011145-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PLA2G16/HRASLS3 Antibody (H00011145-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional PLA2G16/HRASLS3 Products

Bioinformatics Tool for PLA2G16/HRASLS3 Antibody (H00011145-B01P)

Discover related pathways, diseases and genes to PLA2G16/HRASLS3 Antibody (H00011145-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLA2G16/HRASLS3 Antibody (H00011145-B01P)

Discover more about diseases related to PLA2G16/HRASLS3 Antibody (H00011145-B01P).
 

Pathways for PLA2G16/HRASLS3 Antibody (H00011145-B01P)

View related products by pathway.

PTMs for PLA2G16/HRASLS3 Antibody (H00011145-B01P)

Learn more about PTMs related to PLA2G16/HRASLS3 Antibody (H00011145-B01P).
 

Research Areas for PLA2G16/HRASLS3 Antibody (H00011145-B01P)

Find related products by research area.

Blogs on PLA2G16/HRASLS3

There are no specific blogs for PLA2G16/HRASLS3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLA2G16/HRASLS3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PLA2G16
Entrez
Uniprot