PKR Antibody (1D11)

Images

 
Western Blot: PKR Antibody (1D11) [H00005610-M02] - EIF2AK2 monoclonal antibody (M02), clone 1D11 Analysis of EIF2AK2 expression in K-562.
Immunocytochemistry/ Immunofluorescence: PKR Antibody (1D11) [H00005610-M02] - Analysis of monoclonal antibody to EIF2AK2 on HeLa cell. Antibody concentration 30 ug/ml.
Immunohistochemistry-Paraffin: PKR Antibody (1D11) [H00005610-M02] - Analysis of monoclonal antibody to EIF2AK2 on formalin-fixed paraffin-embedded human adrenal gland. Antibody concentration 1.5 ug/ml.
Western Blot: PKR Antibody (1D11) [H00005610-M02] - Analysis of EIF2AK2 expression in transfected 293T cell line by EIF2AK2 monoclonal antibody (M02), clone 1D11.Lane 1: EIF2AK2 transfected lysate(62.1 KDa).Lane 2: ...read more
Sandwich ELISA: PKR Antibody (1D11) [H00005610-M02] - Detection limit for recombinant GST tagged EIF2AK2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
1D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PKR Antibody (1D11) Summary

Immunogen
EIF2AK2 (NP_002750, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGN
Specificity
EIF2AK2 (1D11)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EIF2AK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using H00005610-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PKR Antibody (1D11)

  • double stranded RNA activated protein kinase
  • EC 2.7.11.1
  • eIF-2A protein kinase 2
  • EIF2AK1
  • EIF2AK2
  • eukaryotic translation initiation factor 2-alpha kinase 2P1/eIF-2A protein kinase
  • interferon-induced, double-stranded RNA-activated protein kinase
  • interferon-inducible double stranded RNA dependent
  • interferon-inducible elF2alpha kinase
  • Interferon-inducible RNA-dependent protein kinase
  • P68 Kinase
  • PKR
  • PKRp68 kinase
  • PPP1R83
  • PRKR
  • PRKRMGC126524
  • Protein Kinase R
  • Protein kinase RNA-activated

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-351
Species: Hu, Ha, Pm, Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-02669
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB1980
Species: Hu
Applications: WB, Simple Western, IP, ICC
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP2-48704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
AF4715
Species: Mu
Applications: WB
NBP2-38126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-07321
Species: Hu
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
H00005610-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for PKR Antibody (H00005610-M02)(3)

Reviews for PKR Antibody (H00005610-M02) (0)

There are no reviews for PKR Antibody (H00005610-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PKR Antibody (H00005610-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PKR Products

Bioinformatics Tool for PKR Antibody (H00005610-M02)

Discover related pathways, diseases and genes to PKR Antibody (H00005610-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKR Antibody (H00005610-M02)

Discover more about diseases related to PKR Antibody (H00005610-M02).
 

Pathways for PKR Antibody (H00005610-M02)

View related products by pathway.

PTMs for PKR Antibody (H00005610-M02)

Learn more about PTMs related to PKR Antibody (H00005610-M02).
 

Research Areas for PKR Antibody (H00005610-M02)

Find related products by research area.

Blogs on PKR.

eIF2alpha - a regulator of global translation in response to cellular stress
Eukaryotic initiation factor 2 (eIF2) regulates global protein translation by binding to Met-tRNA and the 40S ribosome to form the pre-initiation complex. eIF2 is a heterotrimer consisting of alpha, beta, and gamma subunits. The 36kDA eIF2a subuni...  Read full blog post.

PKR - Mediating cellular stress responses through multiple signaling pathways
Protein kinase R (PKR) is an intracellular stress-sensing protein that is able to detect and respond to viral infections. While PKR is able to sense and respond to a variety of signals, dsRNA is a well-characterized ligand. dsRNA produced during v...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKR Antibody (1D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2AK2
Entrez
OMIM
Uniprot