PKI-beta Antibody

Images

 
Western Blot: PKI-beta Antibody [NBP1-74255] - Rat Kidney Lysate 1ug/ml Gel Concentration 10-20%

Product Details

Summary
Reactivity Mu, Rt, Hu, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PKI-beta Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of Pkib. Immunizing peptide sequence TDVESVISSFASSARAGRRNALPDIQSSLATGGSPDLALKLEALAVKEDA. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Canine (90%), Equine (90%), Rabbit (100%), Guinea Pig (92%), Bovine (90%), Zebrafish (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PKIB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Pkib and was validated on Western blot.
Theoretical MW
12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-74255 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25704817).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PKI-beta Antibody

  • cAMP-dependent protein kinase inhibitor 2
  • cAMP-dependent protein kinase inhibitor beta
  • FLJ23817
  • PKI-beta
  • PRKACN2
  • protein kinase (cAMP-dependent, catalytic) inhibitor beta

Background

Pkib displays strong inhibition of the activity of cAMP-dependent protein kinase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-14457
Species: Hu
7270-IL/CF
Species: Hu
NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86212
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-37738
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-16287
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-03891
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-03971
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Pm, Rb
Applications: WB, IHC, IHC-P

Publications for PKI-beta Antibody (NBP1-74255)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for PKI-beta Antibody (NBP1-74255) (0)

There are no reviews for PKI-beta Antibody (NBP1-74255). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PKI-beta Antibody (NBP1-74255) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PKI-beta Products

Bioinformatics Tool for PKI-beta Antibody (NBP1-74255)

Discover related pathways, diseases and genes to PKI-beta Antibody (NBP1-74255). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKI-beta Antibody (NBP1-74255)

Discover more about diseases related to PKI-beta Antibody (NBP1-74255).
 

Pathways for PKI-beta Antibody (NBP1-74255)

View related products by pathway.

PTMs for PKI-beta Antibody (NBP1-74255)

Learn more about PTMs related to PKI-beta Antibody (NBP1-74255).

Blogs on PKI-beta

There are no specific blogs for PKI-beta, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKI-beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PKIB
Uniprot