PKC mu Recombinant Protein Antigen

Images

 
There are currently no images for PKC mu Protein (NBP1-87789PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PKC mu Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRKD1.

Source: E.coli

Amino Acid Sequence: RELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEETEMKALGER

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRKD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87789.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for PKC mu Recombinant Protein Antigen

  • EC 2.7.11
  • nPKC-D1
  • nPKC-mu
  • PKCM
  • PKC-MU
  • PKD1
  • PKDEC 2.7.11.13
  • PRKCMPKC-mu
  • PRKD1
  • Protein kinase C mu type
  • protein kinase C, mu
  • Protein kinase D
  • protein kinase D1
  • serine/threonine-protein kinase D1

Background

PKC mu is a novel member of the subgroup of atypical protein kinase Cs (PKC). Deduced protein sequence shows strong homology to conserved domains of members of the PKC subfamily. In vitro phorbol ester binding studies and kinase assays with lysates of cells overexpressing PKC mu showed phorbol ester-independent kinase activity, autophosphorylation, and, in normal rat kidney (NRK) cells, predominant phosphorylation of a 30-kDa protein at serine residues. Data suggest a role of PKC mu in signal transduction pathways related to growth control (1). PKC mu is a cytosolic protein, which upon binding to the trans-Golgi network (TGN) regulates the fission of transport carriers specifically destined to the cell surface. (2). Results demonstrate that betagamma subunits of the heterotrimeric G proteins directly activates PKD by interacting with its pleckstrin homology domain (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-06363
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-02984
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
BC110-60479
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA
NBP1-87948
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-22152
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-27561
Species: Ch, Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
236-EG
Species: Hu
Applications: BA
AF6868
Species: Hu
Applications: IHC, KO, WB
MAB40401
Species: Hu, Mu
Applications: ICC, IHC, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
H00005122-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

Publications for PKC mu Protein (NBP1-87789PEP) (0)

There are no publications for PKC mu Protein (NBP1-87789PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKC mu Protein (NBP1-87789PEP) (0)

There are no reviews for PKC mu Protein (NBP1-87789PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PKC mu Protein (NBP1-87789PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PKC mu Products

Bioinformatics Tool for PKC mu Protein (NBP1-87789PEP)

Discover related pathways, diseases and genes to PKC mu Protein (NBP1-87789PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKC mu Protein (NBP1-87789PEP)

Discover more about diseases related to PKC mu Protein (NBP1-87789PEP).
 

Pathways for PKC mu Protein (NBP1-87789PEP)

View related products by pathway.

PTMs for PKC mu Protein (NBP1-87789PEP)

Learn more about PTMs related to PKC mu Protein (NBP1-87789PEP).
 

Research Areas for PKC mu Protein (NBP1-87789PEP)

Find related products by research area.

Blogs on PKC mu

There are no specific blogs for PKC mu, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PKC mu Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKD1