PKC iota Recombinant Protein Antigen

Images

 
There are currently no images for PKC iota Protein (NBP1-84959PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PKC iota Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRKCI.

Source: E. coli

Amino Acid Sequence: INCKLLVHKKCHKLVTIECGRHSLPQEPVMPMDQSSMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRKCI
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84959.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PKC iota Recombinant Protein Antigen

  • aPKC-lambda/iota
  • Atypical protein kinase C-lambda/iota
  • DXS1179E
  • EC 2.7.11
  • EC 2.7.11.13
  • MGC26534
  • nPKC-iota
  • PKC iota
  • PKCI
  • PRKC-lambda/iota
  • protein kinase C iota type
  • protein kinase C, iota

Background

PKC iota encodes a member of the protein kinase C (PKC) family of serine/threonine protein kinases. The PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes. This protein kinase is calcium-independent and phospholipid-dependent. It is not activated by phorbolesters or diacylglycerol. This kinase can be recruited to vesicle tubular clusters (VTCs) by direct interaction with the small GTPase RAB2, where this kinase phosphorylates glyceraldehyde-3-phosphate dehydrogenase (GAPD/GAPDH) and plays a role in microtubule dynamics in the early secretory pathway. This kinase is found to be necessary for BCL-ABL-mediated resistance to drug-induced apoptosis and therefore protects leukemia cells against drug-induced apoptosis. There is a single exon pseudogene mapped on chromosome X.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-83257
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89062
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-81746
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
MAB5018
Species: Hu
Applications: IP, WB
DTM100
Species: Hu
Applications: ELISA
NBP1-86990
Species: Hu, Mu
Applications: ICC/IF, KD, WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
NBP2-24593
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-78295
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-84959PEP
Species: Hu
Applications: AC

Publications for PKC iota Protein (NBP1-84959PEP) (0)

There are no publications for PKC iota Protein (NBP1-84959PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKC iota Protein (NBP1-84959PEP) (0)

There are no reviews for PKC iota Protein (NBP1-84959PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PKC iota Protein (NBP1-84959PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PKC iota Products

Research Areas for PKC iota Protein (NBP1-84959PEP)

Find related products by research area.

Blogs on PKC iota

There are no specific blogs for PKC iota, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PKC iota Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKCI