PITPNM3 Antibody - BSA Free

Western Blot: PITPNM3 Antibody [NBP3-10019] - Western blot analysis of PITPNM3 in Human ACHN Whole Cell lysates. Antibody dilution at 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PITPNM3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PITPNM3 Antibody - BSA Free (NBP3-10019) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PITPNM3 (NP_112497.2). Peptide sequence FLRKRNHLRRTMSVQQPDPPAANPKPERAQSQPESDKDHERPLPALSWAR
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PITPNM3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 62 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PITPNM3 Antibody - BSA Free

• membrane-associated phosphatidylinositol transfer protein 3
• MGC157740
• MGC157741
• NIR-1
• NIR1CORD5
• Phosphatidylinositol transfer protein, membrane-associated 3
• PITPnm 3
• PITPNM family member 3
• Pyk2 N-terminal domain-interacting receptor 1
• RDGBA3
• retinal degeneration B alpha 3

Background

PITPNM3 is one of a range of Investigative Grade antibodies, made against targets that have limited or no commercial antibodies available to them and for which there are no data on the expression of the protein in the range of common cell lines and tissues available to us. These antibodies are affinity purified using their peptide immunogen and are known to give low background staining in a western blot. However no additional claims are made for their ability to recognise native protein in any application. NIR1 is calcium ion binding, has phosphatidylinositol transporter activity and receptor tyrosine kinase binding.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PITPNM3