PITPNM2 Antibody

Images

 
Immunohistochemistry-Paraffin: PITPNM2 Antibody [NBP1-80994] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PITPNM2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PKDITKWSSNDLMDKIESPEPEDTQDGLYRQGAPEFRVASSVEQLNIIEDEVSQPLAAPPSKIHVLLLVLHGGTILDTGAGDPSSKKGDANTIANVFDTVMRVHYPSALGRLAIRLVPCPPVCSDAFALVSN
Specificity
Specificity of human PITPNM2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PITPNM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using NBP1-80994.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PITPNM2 Antibody

  • phosphatidylinositol transfer protein, membrane-associated 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34132
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33894
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89112
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19842
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
H00056655-Q01
Species: Hu
H00201780-P01
Species: Hu
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00058488-M01
Species: Hu
Applications: WB, ELISA
NBP1-85010
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55940
Species: Hu
Applications: ICC/IF
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80994
Species: Hu
Applications: IHC, IHC-P

Publications for PITPNM2 Antibody (NBP1-80994)(1)

Reviews for PITPNM2 Antibody (NBP1-80994) (0)

There are no reviews for PITPNM2 Antibody (NBP1-80994). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PITPNM2 Antibody (NBP1-80994) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PITPNM2 Products

Bioinformatics Tool for PITPNM2 Antibody (NBP1-80994)

Discover related pathways, diseases and genes to PITPNM2 Antibody (NBP1-80994). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PITPNM2 Antibody (NBP1-80994)

Discover more about diseases related to PITPNM2 Antibody (NBP1-80994).
 

Pathways for PITPNM2 Antibody (NBP1-80994)

View related products by pathway.

PTMs for PITPNM2 Antibody (NBP1-80994)

Learn more about PTMs related to PITPNM2 Antibody (NBP1-80994).

Blogs on PITPNM2

There are no specific blogs for PITPNM2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PITPNM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PITPNM2
Entrez
COVID-19 update