PITPNB Recombinant Protein Antigen

Images

 
There are currently no images for PITPNB Protein (NBP1-86864PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PITPNB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PITPNB.

Source: E. coli

Amino Acid Sequence: CSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PITPNB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86864.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PITPNB Recombinant Protein Antigen

  • phosphatidylinositol transfer protein beta isoform
  • phosphatidylinositol transfer protein, beta
  • phosphotidylinositol transfer protein, beta
  • PI-TP-beta
  • PtdIns transfer protein beta
  • PtdInsTP beta
  • PtdInsTP
  • VIB1B

Background

PITPNB, also known as Phosphatidylinositol Transfer Protein Beta, has two isoforms that are each approximately 32 kDa with 271 and 272 amino acids, respectively. PITPNB is localized to the cytoplasm and expressed in a variety of tissues, including the brain. PITPNB is responsible for catalyzing the transfer of phosphatidylcholine and phosphatidylinositol between membranes. Pathways in which PITPNB plays a role include phospholipid metabolism and PI/PC transport between the ER and Golgi membranes. Current research on PITPNB is being conducted in relation to obesity, and PITPNB has been shown to interact with Von Hippel Lindau, Ubiquitin C, Lamin A and LMO4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6570
Species: Hu
Applications: IHC, WB
AF591
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC
NBP3-06351
Species: Hu
Applications: ICC/IF
H00005306-M01
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
NBP2-34035
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-62693
Species: Hu
Applications: IHC,  IHC-P
NBP2-19842
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-91655
Species: Hu
Applications: IHC,  IHC-P, WB
AF8537
Species: Mu, Rt
Applications: ICC, Simple Western, WB
MAB6896
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-46518
Species: Hu
Applications: IHC,  IHC-P, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-78444
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
H00002316-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, PLA, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
MAB197
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
NBP1-86864PEP
Species: Hu
Applications: AC

Publications for PITPNB Protein (NBP1-86864PEP) (0)

There are no publications for PITPNB Protein (NBP1-86864PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PITPNB Protein (NBP1-86864PEP) (0)

There are no reviews for PITPNB Protein (NBP1-86864PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PITPNB Protein (NBP1-86864PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PITPNB Products

Blogs on PITPNB

There are no specific blogs for PITPNB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PITPNB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PITPNB