PITPNB Antibody (3D3) - Azide and BSA Free

Western Blot: PITPNB Antibody (3D3) [H00023760-M05] - Analysis of PITPNB expression in Jurkat (Cat # L017V1).

Sandwich ELISA: PITPNB Antibody (3D3) [H00023760-M05] - Detection limit for recombinant GST tagged PITPNB is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3D3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PITPNB Antibody (3D3) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PITPNB Antibody (3D3) - Azide and BSA Free (H00023760-M05) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PITPNB (NP_036531, 181 a.a. ~ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV
• Specificity: Reacts with phosphatidylinositol transfer protein, beta.
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PITPNB
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against cell lysate for western blot and recombinant protein in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PITPNB Antibody (3D3) - Azide and BSA Free

• phosphatidylinositol transfer protein beta isoform
• phosphatidylinositol transfer protein, beta
• phosphotidylinositol transfer protein, beta
• PI-TP-beta
• PtdIns transfer protein beta
• PtdInsTP beta
• PtdInsTP
• VIB1B

Background

The protein encoded by this gene is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PITPNB
• Entrez:
  • 23760(Human)
• Uniprot:
  • NP_036531(Human)