PISD Antibody


Western Blot: PISD Antibody [NBP1-84212] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: PISD Antibody [NBP1-84212] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: PISD Antibody [NBP1-84212] - Staining of human placenta shows cytoplasmic positivity in trophoblasts.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

PISD Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHSISPSD
Specificity of human PISD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PISD Protein (NBP1-84212PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PISD Antibody

  • DJ858B16
  • dJ858B16.2
  • DKFZp566G2246
  • EC
  • phosphatidylserine decarboxylase proenzyme
  • phosphatidylserine decarboxylase
  • PSD
  • PSDC
  • PSSC


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ELISA
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for PISD Antibody (NBP1-84212) (0)

There are no publications for PISD Antibody (NBP1-84212).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PISD Antibody (NBP1-84212) (0)

There are no reviews for PISD Antibody (NBP1-84212). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PISD Antibody (NBP1-84212) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PISD Products

PISD NBP1-84212

Bioinformatics Tool for PISD Antibody (NBP1-84212)

Discover related pathways, diseases and genes to PISD Antibody (NBP1-84212). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PISD Antibody (NBP1-84212)

Discover more about diseases related to PISD Antibody (NBP1-84212).

Pathways for PISD Antibody (NBP1-84212)

View related products by pathway.

PTMs for PISD Antibody (NBP1-84212)

Learn more about PTMs related to PISD Antibody (NBP1-84212).

Blogs on PISD

There are no specific blogs for PISD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PISD Antibody and receive a gift card or discount.


Gene Symbol PISD