We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PIP5K2 alpha Recombinant Protein Antigen

Images

 
There are currently no images for PIP5K2 alpha Recombinant Protein Antigen (NBP2-56952PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PIP5K2 alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIP5K2 alpha.

Source: E. coli

Amino Acid Sequence: PGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PIP4K2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56952.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PIP5K2 alpha Recombinant Protein Antigen

  • 1-phosphatidylinositol-4-phosphate kinase
  • 1-phosphatidylinositol-4-phosphate-5-kinase
  • 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha
  • Diphosphoinositide kinase 2-alpha
  • EC 2.7.1
  • EC 2.7.1.149
  • FLJ13267
  • phosphatidylinositol-4-phosphate 5-kinase, type II, alpha
  • Phosphatidylinositol-5-phosphate 4-kinase type II alpha
  • phosphatidylinositol-5-phosphate 4-kinase type-2 alpha
  • phosphatidylinositol-5-phosphate 4-kinase, type II, alpha
  • PI(5)P 4-kinase type II alpha
  • PIP4KII-alpha
  • PIP5K2
  • PIP5K2API5P4KA
  • PIP5KIIA
  • PIP5KIIalpha
  • PIP5KII-alpha
  • PIP5KIII
  • PIPK
  • PtdIns(4)P-5-kinase B isoform
  • PtdIns(4)P-5-kinase C isoform
  • PtdIns(5)P-4-kinase isoform 2-alpha
  • type II phosphatidylinositol-4-phosphate 5-kinase 53 K isoform

Background

Phosphatidylinositol-5,4-bisphosphate, the precursor to second messengers of the phosphoinositide signal transduction pathways, is thought to be involved in the regulation of secretion, cell proliferation, differentiation, and motility. The protein encoded by this gene is one of a family of enzymes capable of catalyzing the phosphorylation of phosphatidylinositol-5-phosphate on the fourth hydroxyl of the myo-inositol ring to form phosphatidylinositol-5,4-bisphosphate. The amino acid sequence of this enzyme does not show homology to other kinases, but the recombinant protein does exhibit kinase activity. This gene is a member of the phosphatidylinositol-5-phosphate 4-kinase family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85299
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP3-48674
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP3-25636
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-29747
Species: Rt
Applications: IHC, WB
NBP3-48516
Species: Hu
Applications: IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-92272
Species: Hu
Applications: IHC,  IHC-P
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-38820
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P
NBL1-09036
Species: Hu
Applications: WB
1129-ER
Species: Hu
Applications: BA
NBP2-93502
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for PIP5K2 alpha Recombinant Protein Antigen (NBP2-56952PEP) (0)

There are no publications for PIP5K2 alpha Recombinant Protein Antigen (NBP2-56952PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIP5K2 alpha Recombinant Protein Antigen (NBP2-56952PEP) (0)

There are no reviews for PIP5K2 alpha Recombinant Protein Antigen (NBP2-56952PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PIP5K2 alpha Recombinant Protein Antigen (NBP2-56952PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIP5K2 alpha Products

Blogs on PIP5K2 alpha

There are no specific blogs for PIP5K2 alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PIP5K2 alpha Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PIP4K2A