PIP5K2 alpha Antibody (3A3) - Azide and BSA Free

Western Blot: PIP5K2 alpha Antibody (3A3) [H00005305-M01] - PIP5K2A monoclonal antibody (M01), clone 3A3 Analysis of PIP5K2A expression in K-562.

Immunohistochemistry-Paraffin: PIP5K2 alpha Antibody (3A3) [H00005305-M01] - Analysis of monoclonal antibody to PIP5K2A on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.

Sandwich ELISA: PIP5K2 alpha Antibody (3A3) [H00005305-M01] - Detection limit for recombinant GST tagged PIP5K2A is approximately 3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 3A3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PIP5K2 alpha Antibody (3A3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PIP5K2A (NP_005019, 304 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKEVYFMAIIDILTHYD
• Localization: Cytoplasmic
• Specificity: PIP5K2A - phosphatidylinositol-4-phosphate 5-kinase, type II, alpha
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PIP4K2A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PIP5K2 alpha Antibody (3A3) - Azide and BSA Free

• 1-phosphatidylinositol-4-phosphate kinase
• 1-phosphatidylinositol-4-phosphate-5-kinase
• 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha
• Diphosphoinositide kinase 2-alpha
• EC 2.7.1
• EC 2.7.1.149
• FLJ13267
• phosphatidylinositol-4-phosphate 5-kinase, type II, alpha
• Phosphatidylinositol-5-phosphate 4-kinase type II alpha
• phosphatidylinositol-5-phosphate 4-kinase type-2 alpha
• phosphatidylinositol-5-phosphate 4-kinase, type II, alpha
• PI(5)P 4-kinase type II alpha
• PIP4KII-alpha
• PIP5K2
• PIP5K2API5P4KA
• PIP5KIIA
• PIP5KIIalpha
• PIP5KII-alpha
• PIP5KIII
• PIPK
• PtdIns(4)P-5-kinase B isoform
• PtdIns(4)P-5-kinase C isoform
• PtdIns(5)P-4-kinase isoform 2-alpha
• type II phosphatidylinositol-4-phosphate 5-kinase 53 K isoform

Background

Phosphatidylinositol-5,4-bisphosphate, the precursor to second messengers of the phosphoinositide signal transduction pathways, is thought to be involved in the regulation of secretion, cell proliferation, differentiation, and motility. The protein encoded by this gene is one of a family of enzymes capable of catalyzing the phosphorylation of phosphatidylinositol-5-phosphate on the fourth hydroxyl of the myo-inositol ring to form phosphatidylinositol-5,4-bisphosphate. The amino acid sequence of this enzyme does not show homology to other kinases, but the recombinant protein does exhibit kinase activity. This gene is a member of the phosphatidylinositol-5-phosphate 4-kinase family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIP4K2A
• Entrez:
  • 5305(Human)
• OMIM:
  • 603140(Human)
• Uniprot:
  • NP_005019(Human)