We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PINCH1/LIMS1 Recombinant Protein Antigen

Images

 
There are currently no images for PINCH1/LIMS1 Recombinant Protein Antigen (NBP2-56112PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PINCH1/LIMS1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PINCH1/LIMS1.

Source: E. coli

Amino Acid Sequence: MTALQLKELSHSGLYRRRRDRPDSLRVNGLPEEELSNMANAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LIMS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56112.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PINCH1/LIMS1 Recombinant Protein Antigen

  • LIM and senescent cell antigen-like domains 1
  • LIM and senescent cell antigen-like-containing domain protein 1
  • LIMS1
  • PINCH1
  • PINCH-1
  • PINCHPINCH1Particularly interesting new Cys-His protein 1
  • Renal carcinoma antigen NY-REN-48

Background

The protein encoded by the LIMS1 gene is an adaptor protein which contains five LIM domains, or double zinc fingers. The protein is likely involved in integrin signaling through its LIM domain-mediated interaction with integrin-linked kinase, found in focal adhesion plaques. It is also thought to act as a bridge linking integrin-linked kinase to NCK adaptor protein 2, which is involved in growth factor receptor kinase signaling pathways. Its localization to the periphery of spreading cells also suggests that this protein may play a role in integrin-mediated cell adhesion or spreading. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41211
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00003611-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
AF5556
Species: Hu
Applications: WB
NBP2-58917
Species: Hu
Applications: IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-31713
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
MAB2005
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP1-90214
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-56929
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-46327
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-86856
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-52575
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB

Publications for PINCH1/LIMS1 Recombinant Protein Antigen (NBP2-56112PEP) (0)

There are no publications for PINCH1/LIMS1 Recombinant Protein Antigen (NBP2-56112PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PINCH1/LIMS1 Recombinant Protein Antigen (NBP2-56112PEP) (0)

There are no reviews for PINCH1/LIMS1 Recombinant Protein Antigen (NBP2-56112PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PINCH1/LIMS1 Recombinant Protein Antigen (NBP2-56112PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PINCH1/LIMS1 Products

Blogs on PINCH1/LIMS1

There are no specific blogs for PINCH1/LIMS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PINCH1/LIMS1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LIMS1