Recombinant Human PINCH1/LIMS1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PINCH1/LIMS1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 226-325 of Human PINCH1/LIMS1

Source: Wheat Germ

Amino Acid Sequence: FLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKPVCKKCYEKFPLELKKRLKKLAETLGRK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
LIMS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PINCH1/LIMS1 Protein

  • LIM and senescent cell antigen-like domains 1
  • LIM and senescent cell antigen-like-containing domain protein 1
  • LIMS1
  • PINCH1
  • PINCH-1
  • PINCHPINCH1Particularly interesting new Cys-His protein 1
  • Renal carcinoma antigen NY-REN-48

Background

The protein encoded by this gene is an adaptor protein which contains five LIM domains, or double zinc fingers. The protein is likely involved in integrin signaling through its LIM domain-mediated interaction with integrin-linked kinase, found in focal adhesion plaques. It is also thought to act as a bridge linking integrin-linked kinase to NCK adaptor protein 2, which is involved in growth factor receptor kinase signaling pathways. Its localization to the periphery of spreading cells also suggests that this protein may play a role in integrin-mediated cell adhesion or spreading. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-37448
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-46326
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31713
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-90214
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-19561
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-46327
Species: Hu
Applications: WB, IHC
NBP1-86856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52575
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for PINCH1/LIMS1 Partial Recombinant Protein (H00003987-Q01) (0)

There are no publications for PINCH1/LIMS1 Partial Recombinant Protein (H00003987-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PINCH1/LIMS1 Partial Recombinant Protein (H00003987-Q01) (0)

There are no reviews for PINCH1/LIMS1 Partial Recombinant Protein (H00003987-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PINCH1/LIMS1 Partial Recombinant Protein (H00003987-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional PINCH1/LIMS1 Products

Bioinformatics Tool for PINCH1/LIMS1 Partial Recombinant Protein (H00003987-Q01)

Discover related pathways, diseases and genes to PINCH1/LIMS1 Partial Recombinant Protein (H00003987-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PINCH1/LIMS1 Partial Recombinant Protein (H00003987-Q01)

Discover more about diseases related to PINCH1/LIMS1 Partial Recombinant Protein (H00003987-Q01).
 

Pathways for PINCH1/LIMS1 Partial Recombinant Protein (H00003987-Q01)

View related products by pathway.

PTMs for PINCH1/LIMS1 Partial Recombinant Protein (H00003987-Q01)

Learn more about PTMs related to PINCH1/LIMS1 Partial Recombinant Protein (H00003987-Q01).

Blogs on PINCH1/LIMS1

There are no specific blogs for PINCH1/LIMS1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PINCH1/LIMS1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LIMS1
COVID-19 update