PIKFyve/PIP5K3 Antibody - BSA Free

Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PIKFyve/PIP5K3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NVELDNVNFHIKKPSKYPHVPPHPADQKEYLISDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENGEKQA
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIKFYVE
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PIKFyve/PIP5K3 Protein (NBP1-89613PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PIKFyve/PIP5K3 Antibody - BSA Free

• 1-phosphatidylinositol-3-phosphate 5-kinase
• EC 2.7.1.150
• FAB1
• FLJ37746
• FYVE finger-containing phosphoinositide kinase
• KIAA0981CFD
• MGC40423
• p235
• Phosphatidylinositol-3-phosphate 5-kinase type III
• Phosphatidylinositol-3-phosphate 5-kinase
• phosphoinositide kinase, FYVE finger containing
• PIKFyve
• PIP5K
• PIP5K3
• PIP5K3FAB1
• PIPkin-III
• Type III PIP kinase
• type III

Background

PIP5K3 belongs to a large family of lipid kinases that alter the phosphorylation status of intracellular phosphatidylinositol. Signaling by phosphorylated species of phosphatidylinositol regulates diverse cellular processes, including membrane trafficking and cytoskeletal reorganization (Shisheva et al., 1999 [PubMed 9858586]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIKFYVE