PIK4CA Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PIK4CA Antibody [NBP2-57995] - Staining of human cell line MCF7 shows localization to nucleoplasm & plasma membrane.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIK4CA Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DMLALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYG
Specificity
Specificity of human PIK4CA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PI4KA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PIK4CA Recombinant Protein Antigen (NBP2-57995PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PIK4CA Antibody

  • EC 2.7.1.67
  • FLJ16556
  • phosphatidylinositol 4-kinase alpha
  • phosphatidylinositol 4-kinase, catalytic, alpha
  • phosphatidylinositol 4-kinase, type III, alpha
  • pi4K230
  • PI4K-ALPHA
  • PI4-kinase alpha
  • PIK4
  • PIK4CAphosphatidylinositol 4-kinase 230
  • PtdIns-4-kinase alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80907
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46076
Species: Hu
Applications: WB, IHC
NBP2-67791
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-61614
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-74502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33050
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38535
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-62710
Species: Hu
Applications: IHC, IHC-P
NBP1-94015
Species: Hu
Applications: IHC, IHC-P
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP1-59337
Species: Hu
Applications: WB
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-67486
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP

Publications for PIK4CA Antibody (NBP2-57995) (0)

There are no publications for PIK4CA Antibody (NBP2-57995).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIK4CA Antibody (NBP2-57995) (0)

There are no reviews for PIK4CA Antibody (NBP2-57995). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PIK4CA Antibody (NBP2-57995) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PIK4CA Antibody (NBP2-57995)

Discover related pathways, diseases and genes to PIK4CA Antibody (NBP2-57995). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIK4CA Antibody (NBP2-57995)

Discover more about diseases related to PIK4CA Antibody (NBP2-57995).
 

Pathways for PIK4CA Antibody (NBP2-57995)

View related products by pathway.

Blogs on PIK4CA

There are no specific blogs for PIK4CA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIK4CA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PI4KA