PIK3R5 Recombinant Protein Antigen

Images

 
There are currently no images for PIK3R5 Recombinant Protein Antigen (NBP2-57055PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PIK3R5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIK3R5.

Source: E. coli

Amino Acid Sequence: AISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYKP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PIK3R5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57055.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PIK3R5 Recombinant Protein Antigen

  • F730038I15Rik
  • FOAP-2
  • p101
  • p101-PI3K
  • Phosphatidylinositol-4,5-bisphosphate 3-kinase regulatory subunit
  • phosphoinositide-3-kinase, regulatory subunit 5
  • phosphoinositide-3-kinase, regulatory subunit, polypeptide p101
  • PI3-kinase p101 subunit
  • PI3-kinase regulatory subunit 5
  • PIK3R5
  • PtdIns-3-kinase regulatory subunit
  • regulatory subunit 5, p101

Background

Phosphatidylinositol 3-kinase (PI 3-kinase) is composed of 85 kDa (p85) and 110 kDa (p110) subunits. p85 lacks PI 3-kinase activity and acts as an adapter, coupling p110 to activated protein tyrosine kinase. Two forms of p85 have been described (p85alpha and p85beta), each possessing one SH3 and two SH2 domains. Various p110 isoforms have been identified. p110alpha and p110beta interact with p85alpha, and p110alpha has also been shown to interact with p85beta in vitro. p110delta expression is restricted to white blood cells. It has been shown to bind p85alpha and beta, but it apparently does not phosphorylate these subunits. p110delta seems to have the capacity to autophosphorylate. p110gamma does not interact with the p85 subunits. It has been shown to be activated by alpha and betagamma heterotrimeric G proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NB100-74648
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-48560
Species: Hu
Applications: IHC,  IHC-P
NBP2-67058
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-88650
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP1-90078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-34136
Species: Hu
Applications: IHC,  IHC-P, WB
MAB6777
Species: Hu
Applications: ICC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB
NB100-1919
Species: Ca, Fe, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-88899
Species: Hu
Applications: IHC,  IHC-P
NB100-65530
Species: Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-85841
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for PIK3R5 Recombinant Protein Antigen (NBP2-57055PEP) (0)

There are no publications for PIK3R5 Recombinant Protein Antigen (NBP2-57055PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIK3R5 Recombinant Protein Antigen (NBP2-57055PEP) (0)

There are no reviews for PIK3R5 Recombinant Protein Antigen (NBP2-57055PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PIK3R5 Recombinant Protein Antigen (NBP2-57055PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIK3R5 Products

Blogs on PIK3R5

There are no specific blogs for PIK3R5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PIK3R5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3R5