PIGZ Antibody

Images

 
Immunohistochemistry-Paraffin: PIGZ Antibody [NBP2-32394] - Staining of human colon shows strong luminal membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIGZ Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DSWYFSSPATSRNLVLTPVNFLHYNLNPQNLARHGTHARLTHL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIGZ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PIGZ Protein (NBP2-32394PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIGZ Antibody

  • class Z
  • EC 2.4.1
  • EC 2.4.1.-
  • FLJ12768
  • GPI mannosyltransferase 4
  • GPI mannosyltransferase IV
  • GPI-MT-IV
  • hSMP3
  • phosphatidylinositol glycan anchor biosynthesis, class Z
  • Phosphatidylinositol-glycan biosynthesis class Z protein
  • PIG-Z
  • SMP3 mannosyltransferase
  • SMP3SMP3 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP1-62449
Species: Hu
Applications: WB, IHC, IHC-P
AF4064
Species: Mu
Applications: WB, ICC
NBP2-13761
Species: Hu
Applications: IHC, IHC-P
NBL1-12830
Species: Hu
NBP1-90191
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02860
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-56262
Species: Hu
Applications: ICC/IF
NBP2-20464
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13760
Species: Hu
Applications: IHC, IHC-P
NBP1-83810
Species: Hu
Applications: IHC, IHC-P
NBP1-53181
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81801
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90235
Species: Hu, Mu, Rt, ChHa
Applications: WB, Simple Western, IHC, IHC-P

Publications for PIGZ Antibody (NBP2-32394) (0)

There are no publications for PIGZ Antibody (NBP2-32394).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGZ Antibody (NBP2-32394) (0)

There are no reviews for PIGZ Antibody (NBP2-32394). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PIGZ Antibody (NBP2-32394) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIGZ Products

Bioinformatics Tool for PIGZ Antibody (NBP2-32394)

Discover related pathways, diseases and genes to PIGZ Antibody (NBP2-32394). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGZ Antibody (NBP2-32394)

Discover more about diseases related to PIGZ Antibody (NBP2-32394).

Blogs on PIGZ

There are no specific blogs for PIGZ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIGZ Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGZ