Recombinant Human PIGB Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PIGB Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 80-172 of Human PIGB

Source: Wheat Germ

Amino Acid Sequence: TSFVPDEYWQSLEVSHHMVFNYGYLTWEWTERLRSYTYPLIFASIYKILHLLGKDSVQLLIWIPRLAQALLSAVADVRLYSLMKQLENQEVAR

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PIGB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
35.97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PIGB Protein

  • EC 2.4.1
  • EC 2.4.1.-
  • GPI mannosyltransferase 3
  • GPI mannosyltransferase III
  • GPI-MT-III
  • MGC21236
  • phosphatidylinositol glycan anchor biosynthesis, class B
  • phosphatidylinositol glycan, class B
  • Phosphatidylinositol-glycan biosynthesis class B protein
  • PIG-B

Background

PIGB - phosphatidylinositol glycan, class B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59701
Species: Hu, Mu, Rt, Po, Bv, Ca, Rb
Applications: WB
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC, IHC-P
NBP1-69251
Species: Hu, Mu, Rt, Bv, Eq, GP, Rb, Ye
Applications: WB
NBP1-05034
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-62449
Species: Hu, Mu, Rt, Bv, Ca, GP, Rb, Ze
Applications: WB, IHC, IHC-P
H00093183-Q01
Species: Hu
NBP1-90191
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79871
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP1-31564
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-69261
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Sh
Applications: WB, IHC
NBP1-62435
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
NBP1-42827
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Eq, Fe, Ha, Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single Cell Western
NBP1-83404
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-86471
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81000
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00009488-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PIGB Partial Recombinant Protein (H00009488-Q01) (0)

There are no publications for PIGB Partial Recombinant Protein (H00009488-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGB Partial Recombinant Protein (H00009488-Q01) (0)

There are no reviews for PIGB Partial Recombinant Protein (H00009488-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIGB Partial Recombinant Protein (H00009488-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional PIGB Products

Array H00009488-Q01

Bioinformatics Tool for PIGB Partial Recombinant Protein (H00009488-Q01)

Discover related pathways, diseases and genes to PIGB Partial Recombinant Protein (H00009488-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGB Partial Recombinant Protein (H00009488-Q01)

Discover more about diseases related to PIGB Partial Recombinant Protein (H00009488-Q01).
 

Pathways for PIGB Partial Recombinant Protein (H00009488-Q01)

View related products by pathway.

PTMs for PIGB Partial Recombinant Protein (H00009488-Q01)

Learn more about PTMs related to PIGB Partial Recombinant Protein (H00009488-Q01).

Blogs on PIGB

There are no specific blogs for PIGB, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PIGB Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGB