PIB5PA Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PIB5PA Antibody - BSA Free (NBP2-82309) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PIB5PA. Peptide sequence: SSRERRGASRSPSPQSRRLSRVAPDRSSNGSSRGSSEEGPSGLPGPWAFP The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
INPP5J |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
110 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for PIB5PA Antibody - BSA Free
Background
PIB5PA, also referred to as Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A, has a long isoform that is 1,006 amino acids in length and 107 kDa, and two shorter isoforms that are 639 and 638 amino acids long. It is known that PIB5PA converts phosphatidylinositol 4,5-bisphosphate to phosphatidylinositol 4-phosphate, and it is thought that PIB5PA may mediate the function of plasma membrane proteins. Research is currently being conducted on PIB5PA in relation to several diseases and disorders including breast cancer, Guillain-Barre syndrome, developmental disorders and Autoimmune Lymphoproliferative Syndrome. PIB5PA has also been shown to have interactions with INPP1, PTEN, ITPK1, INPP4A and ITPKA in pathways such as lipid metabolism and lipoprotein metabolism.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Publications for PIB5PA Antibody (NBP2-82309) (0)
There are no publications for PIB5PA Antibody (NBP2-82309).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PIB5PA Antibody (NBP2-82309) (0)
There are no reviews for PIB5PA Antibody (NBP2-82309).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PIB5PA Antibody (NBP2-82309) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PIB5PA Products
Research Areas for PIB5PA Antibody (NBP2-82309)
Find related products by research area.
|
Blogs on PIB5PA