Recombinant Human PIAS2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PIAS2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-572 of Human PIAS2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGSVLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDEEEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPISSMSSDLPGEQRRNDINNELKLGTSSDTVQQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PIAS2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PIAS2 Protein

  • Androgen receptor-interacting protein 3
  • ARIP3
  • DAB2-interacting protein
  • DIP
  • E3 SUMO-protein ligase PIAS2
  • MGC102682
  • miz
  • MIZ1
  • Msx-interacting zinc finger protein
  • Msx-interacting-zinc finger
  • PIAS2
  • PIAS-NY protein
  • PIASx alpha
  • PIASX
  • PIASX-ALPHA
  • PIASX-BETA
  • Protein inhibitor of activated STAT x
  • protein inhibitor of activated STAT, 2
  • Protein inhibitor of activated STAT2
  • SIZ2
  • zinc finger, MIZ-type containing 4
  • ZMIZ4

Background

This gene encodes a protein involved in the regulation of transcription factors involved in MAP kinase signaling. The symbol MIZ1 has also been associated with ZBTB17 which is a different gene located on chromosome 1. Two alternatively spliced transcripts encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF7177
Species: Hu
Applications: WB, ICC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-77158
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P

Publications for PIAS2 Recombinant Protein (H00009063-P01) (0)

There are no publications for PIAS2 Recombinant Protein (H00009063-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIAS2 Recombinant Protein (H00009063-P01) (0)

There are no reviews for PIAS2 Recombinant Protein (H00009063-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIAS2 Recombinant Protein (H00009063-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIAS2 Products

Bioinformatics Tool for PIAS2 Recombinant Protein (H00009063-P01)

Discover related pathways, diseases and genes to PIAS2 Recombinant Protein (H00009063-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIAS2 Recombinant Protein (H00009063-P01)

Discover more about diseases related to PIAS2 Recombinant Protein (H00009063-P01).
 

Pathways for PIAS2 Recombinant Protein (H00009063-P01)

View related products by pathway.

PTMs for PIAS2 Recombinant Protein (H00009063-P01)

Learn more about PTMs related to PIAS2 Recombinant Protein (H00009063-P01).

Blogs on PIAS2

There are no specific blogs for PIAS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PIAS2 Antibody
NBP2-19819
Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PIAS2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PIAS2
Entrez