PHPT1 Antibody

Images

 
Immunohistochemistry-Paraffin: PHPT1 Antibody [NBP1-88804] - Staining of human colon shows strong cytoplasmic positivity of mucus in the goblet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHPT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHPT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PHPT1 Protein (NBP1-88804PEP)
Publications
Read Publication using NBP1-88804.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHPT1 Antibody

  • bA216L13.10
  • DKFZp564M173
  • EC 3.1.3,14 kDa phosphohistidine phosphatase
  • EC 3.1.3.-
  • HSPC141
  • phosphohistidine phosphatase 11700008C22Rik
  • phosphohistidine phosphatase 14kDa
  • PHP14CGI-202
  • Protein janus-A homolog
  • RP11-216L13.10
  • sex-regulated protein janus-a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2569
Species: Hu
Applications: WB, ICC
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33694
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP2-37429
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP1-32521
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for PHPT1 Antibody (NBP1-88804)(1)

Reviews for PHPT1 Antibody (NBP1-88804) (0)

There are no reviews for PHPT1 Antibody (NBP1-88804). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PHPT1 Antibody (NBP1-88804) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHPT1 Products

Bioinformatics Tool for PHPT1 Antibody (NBP1-88804)

Discover related pathways, diseases and genes to PHPT1 Antibody (NBP1-88804). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHPT1 Antibody (NBP1-88804)

Discover more about diseases related to PHPT1 Antibody (NBP1-88804).
 

Pathways for PHPT1 Antibody (NBP1-88804)

View related products by pathway.

PTMs for PHPT1 Antibody (NBP1-88804)

Learn more about PTMs related to PHPT1 Antibody (NBP1-88804).
 

Research Areas for PHPT1 Antibody (NBP1-88804)

Find related products by research area.

Blogs on PHPT1

There are no specific blogs for PHPT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHPT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHPT1