Phosphorylase B Antibody (2E9) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
PHKB (NP_000284, 984 a.a. ~ 1093 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDTLGNIDQPQYRQIVVELLMVVSIVLERNPELEFQDKVDLDRLVKEAFNEFQKDQSRLKEIEKQDDMTSFYNTPPLGKRGTCSYLTKAVMNLLLEGEVKPNNDDPCLIS |
| Specificity |
PHKB (2E9) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
PHKB |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Phosphorylase B Antibody (2E9) - Azide and BSA Free
Background
Phosphorylase B, also known by its gene name, PHKB, is an enzyme localized to the plasma membrane that catalyzes the phosphorylation of the amino acid residue Serine. Phosphorylase B has a 1,093 amino acid long isoform that is 125 kDa (the canonical sequence) and three other isoforms derived from alternative splicing. Current research on PHKB is being performed relating to several diseases and disorders including hepatitis and metabolic disorders, such as hypoglycemia and glycogen storage disease. Phosphorylase B has also been shown to have interactions with B Raf, hnRNP C1 + C2, PASK, and UBE3A in pathways such as Glucose and Glycogen Metabolism, PKA Signaling, cAMP Pathway, Insulin Signaling Pathway and Calcium Signaling Pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ye
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Ze
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, WB
Publications for Phosphorylase B Antibody (H00005257-M02) (0)
There are no publications for Phosphorylase B Antibody (H00005257-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Phosphorylase B Antibody (H00005257-M02) (0)
There are no reviews for Phosphorylase B Antibody (H00005257-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Phosphorylase B Antibody (H00005257-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Phosphorylase B Products
Research Areas for Phosphorylase B Antibody (H00005257-M02)
Find related products by research area.
|
Blogs on Phosphorylase B