Phospholipase C delta 1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: QDDEDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMRTPESQLFSIEDIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLD |
| Predicted Species |
Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PLCD1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Phospholipase C delta 1 Antibody - BSA Free
Background
Phospholipase C delta 1, also known by its gene name PLCD1, has a 756 amino acid long isoform that is approximately 86 kDa and a 777 amino acid long isoform that is approximately 88 kDa. Phospholipase C delta 1 is a member of the phospholipase C family and plays a critical role in the production of intercellular second messenger molecules. Phospholipase C delta 1 is a tumor suppressor and mutations in PLCD1 may be a cause of hereditary leukonychia. Currently research on Phospholipase C delta 1 is related to several diseases and disorders including nail disorders, squamous cell carcinoma, Huntington's disease, Alzheimer's disease, colon carcinoma, breast cancer, esophagitis and hypertension. Phospholipase C delta 1 has also been shown to interact with CALM1, CALM2, CALM3, TGM2 and KPNB1 in pathways such as IGF1R signaling, PKA signaling, sweet taste signaling and CREB Pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for Phospholipase C delta 1 Antibody (NBP1-87552) (0)
There are no publications for Phospholipase C delta 1 Antibody (NBP1-87552).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Phospholipase C delta 1 Antibody (NBP1-87552) (0)
There are no reviews for Phospholipase C delta 1 Antibody (NBP1-87552).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Phospholipase C delta 1 Antibody (NBP1-87552) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Phospholipase C delta 1 Products
Research Areas for Phospholipase C delta 1 Antibody (NBP1-87552)
Find related products by research area.
|
Blogs on Phospholipase C delta 1