Phospholamban Antibody


Western Blot: Phospholamban Antibody [NBP1-85543] - Analysis in human heart tissue.
Immunohistochemistry-Paraffin: Phospholamban Antibody [NBP1-85543] - Staining of human skin shows low expression as expected.
Immunohistochemistry-Paraffin: Phospholamban Antibody [NBP1-85543] - Staining of human heart muscle shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Phospholamban Antibody [NBP1-85543] - Staining in human heart muscle and skin tissues using anti-PLN antibody. Corresponding PLN RNA-seq data are presented more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Phospholamban Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EKVQYLTRSAIRRASTIEMPQQARQKLQNL
Specificity of human Phospholamban antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Phospholamban Recombinant Protein Antigen (NBP1-85543PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Phospholamban Antibody

  • CMD1PPLBcardiac phospholamban
  • phospholamban


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Am, Ca, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Phospholamban Antibody (NBP1-85543) (0)

There are no publications for Phospholamban Antibody (NBP1-85543).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phospholamban Antibody (NBP1-85543) (0)

There are no reviews for Phospholamban Antibody (NBP1-85543). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Phospholamban Antibody (NBP1-85543) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Phospholamban Products

Bioinformatics Tool for Phospholamban Antibody (NBP1-85543)

Discover related pathways, diseases and genes to Phospholamban Antibody (NBP1-85543). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phospholamban Antibody (NBP1-85543)

Discover more about diseases related to Phospholamban Antibody (NBP1-85543).

Pathways for Phospholamban Antibody (NBP1-85543)

View related products by pathway.

PTMs for Phospholamban Antibody (NBP1-85543)

Learn more about PTMs related to Phospholamban Antibody (NBP1-85543).

Research Areas for Phospholamban Antibody (NBP1-85543)

Find related products by research area.

Blogs on Phospholamban

There are no specific blogs for Phospholamban, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Phospholamban Antibody and receive a gift card or discount.


Gene Symbol PLN