We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PHKG2 Recombinant Protein Antigen

Images

 
There are currently no images for PHKG2 Recombinant Protein Antigen (NBP2-55815PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PHKG2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PHKG2.

Source: E. coli

Amino Acid Sequence: QNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PHKG2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55815.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PHKG2 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.19
  • GSD9C
  • PHK-gamma-T
  • phosphorylase b kinase gamma catalytic chain, testis/liver isoform
  • Phosphorylase kinase subunit gamma-2
  • phosphorylase kinase, gamma 2 (testis)
  • Phosphorylase kinase, gamma 2 (testis/liver)
  • PSK-C3

Background

PHKG2, also known as Phosphorylase b kinase gamma catalytic chain, liver/testis isoform, has 2 isoforms, a 406 amino acid long isoform that is 46 kDa and a short 374 amino acid isoform that is 43 kDa, as catalytic subunit of the phosphorylase b kinase (PHK) mediates the neural and hormonal regulation of glycogen breakdown (glycogenolysis) by phosphorylating and thereby activating glycogen phosphorylase and may regulate glycogeneolysis in the testis and phosphorylates PYGM in vitro. Studies on this protein have shown a relationship with the following diseases and disorders: glycogen storage disease, cirrhosis due to liver, phosphorylase kinase deficiency, hepatitis, metabolic disorders, hypotonia malaria, and alcoholism. This protein has interactions with PHKG1, UBE3A, PHKA2, PHKB, and PYGL in PKA signaling, cAMP Pathway, activation of cAMP-dependent PKA, alpha-adrenergic signaling, metabolism of carbohydrates, glycogen breakdown (glycogenolysis), glucose metabolism, calcium signaling pathway and insulin signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-47161
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP3-47160
Species: Hu, Mu
Applications: ELISA, IHC, IP, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP2-16991
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-46595
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-89602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1060
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
AF640
Species: Mu
Applications: IHC, WB
NBP1-86182
Species: Hu
Applications: ICC/IF,  IHC-P, WB
NBP1-92350
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-50465
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC,  IHC-P
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85786
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-35291
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NB100-2614
Species: Hu
Applications: CyTOF-ready, Flow, IF, IHC, IP
NBP2-88128
Species: Hu
Applications: IHC,  IHC-P, WB
DGP00
Species: Hu
Applications: ELISA
NBP2-55815PEP
Species: Hu
Applications: AC

Publications for PHKG2 Recombinant Protein Antigen (NBP2-55815PEP) (0)

There are no publications for PHKG2 Recombinant Protein Antigen (NBP2-55815PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHKG2 Recombinant Protein Antigen (NBP2-55815PEP) (0)

There are no reviews for PHKG2 Recombinant Protein Antigen (NBP2-55815PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PHKG2 Recombinant Protein Antigen (NBP2-55815PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PHKG2 Products

Research Areas for PHKG2 Recombinant Protein Antigen (NBP2-55815PEP)

Find related products by research area.

Blogs on PHKG2

There are no specific blogs for PHKG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PHKG2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PHKG2