PHKA2 Antibody (3H3)

Images

 
Immunohistochemistry-Paraffin: PHKA2 Antibody (3H3) [H00005256-M04] - Analysis of monoclonal antibody to PHKA2 on formalin-fixed paraffin-embedded human uterine cervix. Antibody concentration 3 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IHC, IHC-P
Clone
3H3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PHKA2 Antibody (3H3) Summary

Immunogen
PHKA2 (NP_000283, 428 a.a. ~ 521 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RRFSTSVKPDVVVQVTVLAENNHIKDLLRKHGVNVQSIADIHPIQVQPGRILSHIYAKLGRNKNMNLSGRPYRHIGVLGTSKLYVIRNQIFTFT
Specificity
PHKA2 - phosphorylase kinase, alpha 2 (liver) (3H3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PHKA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PHKA2 Antibody (3H3)

  • GSD9A
  • MGC133071
  • PHK
  • PHKLA
  • phosphorylase b kinase regulatory subunit alpha liver isoform
  • phosphorylase b kinase regulatory subunit alpha, liver isoform
  • Phosphorylase kinase alpha L subunit
  • phosphorylase kinase alpha-subunit
  • phosphorylase kinase, alpha 2 (liver)
  • PYK
  • PYKL
  • XLG
  • XLG2

Background

PHKA2, also known as Phosphorylase b kinase regulatory subunit alpha, liver isoform, is a 1,235 amino acid protein that is 138 kDa, predominantly expressed in liver and other non-muscle tissues, acts as a catalyzer of the phosphorylation of serine in certain substrates, including troponin I, and its alpha chain may bind calmodulin. This protein has been linked to several diseases and disorders including glycogen storage disease, x-linked liver glycogenosis type 1, hepatitis, glycogen storage disease, type ixa2, glycogen storage disease, type ixa1, coffin-lowry syndrome, muscle glycogenosis, Japanese encephalitis, retinoschisis, metabolic disorders, encephalitis, chagas disease, fanconi syndrome, hepatitis c hypertriglyceridemia, myopathy, hypercholesterolemia, hepatocellular carcinoma, psoriasis, and pneumonia. The PHKA2 protein has also shown an interaction with SMAD9, UBE3A, RAF1, LMLN, and METTL13 in the metabolism of carbohydrates, glycogen breakdown (glycogenolysis), metabolism, glucose metabolism, calcium signaling pathway, insulin signaling pathway, and signal transduction cAMP signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6210
Species: Hu
Applications: Simple Western, WB
NBP2-33950
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB3428
Species: Hu
Applications: IHC, WB
NBP1-89781
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
H00005257-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-31600
Species: Bv, Hu, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
NBP1-87281
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
2667-CM
Species: Hu
Applications: Bind, BA
NBP1-31470
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-46393
Species: Hu, Mu
Applications: IHC, WB
NBP3-05078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89559
Species: Hu
Applications: IHC, IHC-P, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NBP2-33606
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32975
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00005256-M04
Species: Hu
Applications: ELISA, IHC, IHC-P

Publications for PHKA2 Antibody (H00005256-M04) (0)

There are no publications for PHKA2 Antibody (H00005256-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHKA2 Antibody (H00005256-M04) (0)

There are no reviews for PHKA2 Antibody (H00005256-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PHKA2 Antibody (H00005256-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHKA2 Products

Bioinformatics Tool for PHKA2 Antibody (H00005256-M04)

Discover related pathways, diseases and genes to PHKA2 Antibody (H00005256-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHKA2 Antibody (H00005256-M04)

Discover more about diseases related to PHKA2 Antibody (H00005256-M04).
 

Pathways for PHKA2 Antibody (H00005256-M04)

View related products by pathway.

PTMs for PHKA2 Antibody (H00005256-M04)

Learn more about PTMs related to PHKA2 Antibody (H00005256-M04).

Blogs on PHKA2

There are no specific blogs for PHKA2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHKA2 Antibody (3H3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PHKA2
Entrez
Uniprot