Recombinant Human PHF2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PHF2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2-100 of Human PHF2

Source: Wheat Germ

Amino Acid Sequence: ATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRTWHKHGPGQAPDVKPVQNGSQLFIKELRSRTFPS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PHF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PHF2 Protein

  • GRC5
  • jumonji C domain-containing histone demethylase 1E
  • KIAA0662JHDM1E
  • MGC176680
  • PHD finger protein 2

Background

PHF2 - PHD finger protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82853
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00051068-P01
Species: Hu
NB100-81657
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-18979
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
H00008294-P01
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NB100-93321
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-93313
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
H00008363-P01
Species: Hu
H00008362-P01
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
H00005253-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PHF2 Partial Recombinant Protein (H00005253-Q01) (0)

There are no publications for PHF2 Partial Recombinant Protein (H00005253-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF2 Partial Recombinant Protein (H00005253-Q01) (0)

There are no reviews for PHF2 Partial Recombinant Protein (H00005253-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHF2 Partial Recombinant Protein (H00005253-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for PHF2 Partial Recombinant Protein (H00005253-Q01)

Discover related pathways, diseases and genes to PHF2 Partial Recombinant Protein (H00005253-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF2 Partial Recombinant Protein (H00005253-Q01)

Discover more about diseases related to PHF2 Partial Recombinant Protein (H00005253-Q01).
 

Pathways for PHF2 Partial Recombinant Protein (H00005253-Q01)

View related products by pathway.

PTMs for PHF2 Partial Recombinant Protein (H00005253-Q01)

Learn more about PTMs related to PHF2 Partial Recombinant Protein (H00005253-Q01).
 

Research Areas for PHF2 Partial Recombinant Protein (H00005253-Q01)

Find related products by research area.

Blogs on PHF2

There are no specific blogs for PHF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PHF2 Antibody
NBP1-83080

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PHF2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF2