Recombinant Human PHF2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PHF2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 2 - 100 of Human PHF2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRTWHKHGPGQAPDVKPVQNGSQLFIKELRSRTFPS

Protein/Peptide Type
Partial Recombinant Protein
Gene
PHF2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PHF2 Protein

  • GRC5
  • jumonji C domain-containing histone demethylase 1E
  • KIAA0662JHDM1E
  • MGC176680
  • PHD finger protein 2

Background

PHF2 - PHD finger protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82853
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98594
Species: Hu
Applications: WB
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-18979
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-93321
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-93313
Species: Hu
Applications: WB, ChIP, IHC-P, IP, PLA
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
H00005253-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PHF2 Partial Recombinant Protein (H00005253-Q01) (0)

There are no publications for PHF2 Partial Recombinant Protein (H00005253-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF2 Partial Recombinant Protein (H00005253-Q01) (0)

There are no reviews for PHF2 Partial Recombinant Protein (H00005253-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHF2 Partial Recombinant Protein (H00005253-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PHF2 Products

Bioinformatics Tool for PHF2 Partial Recombinant Protein (H00005253-Q01)

Discover related pathways, diseases and genes to PHF2 Partial Recombinant Protein (H00005253-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF2 Partial Recombinant Protein (H00005253-Q01)

Discover more about diseases related to PHF2 Partial Recombinant Protein (H00005253-Q01).
 

Pathways for PHF2 Partial Recombinant Protein (H00005253-Q01)

View related products by pathway.

PTMs for PHF2 Partial Recombinant Protein (H00005253-Q01)

Learn more about PTMs related to PHF2 Partial Recombinant Protein (H00005253-Q01).
 

Research Areas for PHF2 Partial Recombinant Protein (H00005253-Q01)

Find related products by research area.

Blogs on PHF2

There are no specific blogs for PHF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PHF2 Antibody
NBP1-83080

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PHF2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF2