Recombinant Human PHF19 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PHF19 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-207 of Human PHF19 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MENRALDPGTRDSYGATSHLPNKGALAKVKNNFKDLMSKLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILICGKCGLGYHQQCHIPIAGSADQPLLTPWFCRRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALETDSASATVLGQDL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PHF19

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PHF19 Protein

  • DKFZP727G051
  • hPCL3
  • MGC131698
  • MGC149712
  • MGC23929
  • MTF2L1
  • PCL3MGC149713
  • PHD finger protein 19
  • polycomb like 3
  • polycomb-like 3
  • Polycomb-like protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6846
Species: Hu
Applications: IHC
MAB4184
Species: Hu, Mu
Applications: WB, IP, ICC
H00003090-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NB100-56170
Species: Hu, Bv, Ca
Applications: WB, IHC, IHC-P, IP
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF6394
Species: Hu
Applications: WB, IP
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
NB100-137
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-82613
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31318
Species: Mu
Applications: IHC-P
NBP1-06640
Species: Hu, Mu
Applications: WB, Flow, ICC/IF

Publications for PHF19 Recombinant Protein (H00026147-P01) (0)

There are no publications for PHF19 Recombinant Protein (H00026147-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF19 Recombinant Protein (H00026147-P01) (0)

There are no reviews for PHF19 Recombinant Protein (H00026147-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHF19 Recombinant Protein (H00026147-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PHF19 Products

Bioinformatics Tool for PHF19 Recombinant Protein (H00026147-P01)

Discover related pathways, diseases and genes to PHF19 Recombinant Protein (H00026147-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF19 Recombinant Protein (H00026147-P01)

Discover more about diseases related to PHF19 Recombinant Protein (H00026147-P01).
 

Pathways for PHF19 Recombinant Protein (H00026147-P01)

View related products by pathway.

PTMs for PHF19 Recombinant Protein (H00026147-P01)

Learn more about PTMs related to PHF19 Recombinant Protein (H00026147-P01).

Blogs on PHF19

There are no specific blogs for PHF19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PHF19 Antibody
H00026147-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PHF19 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF19