Recombinant Human PHF1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PHF1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 2 - 100 of Human PHF1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PHF1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PHF1 Protein

  • hPCl1
  • MTF2L2
  • PCL1
  • PHD finger protein 1
  • PHF2
  • Polycomb-like protein 1
  • Protein PHF1

Background

PHF1 - PHD finger protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF6846
Species: Hu
Applications: IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31758
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
MAB4184
Species: Hu, Mu
Applications: WB, IP, ICC
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NBP2-57403
Species: Hu
Applications: WB, ICC/IF
NBP1-71865
Species: Hu
Applications: WB, IP, PLA
NBP2-29965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PHF1 Partial Recombinant Protein (H00005252-Q01) (0)

There are no publications for PHF1 Partial Recombinant Protein (H00005252-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF1 Partial Recombinant Protein (H00005252-Q01) (0)

There are no reviews for PHF1 Partial Recombinant Protein (H00005252-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHF1 Partial Recombinant Protein (H00005252-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PHF1 Products

Bioinformatics Tool for PHF1 Partial Recombinant Protein (H00005252-Q01)

Discover related pathways, diseases and genes to PHF1 Partial Recombinant Protein (H00005252-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF1 Partial Recombinant Protein (H00005252-Q01)

Discover more about diseases related to PHF1 Partial Recombinant Protein (H00005252-Q01).
 

Pathways for PHF1 Partial Recombinant Protein (H00005252-Q01)

View related products by pathway.

PTMs for PHF1 Partial Recombinant Protein (H00005252-Q01)

Learn more about PTMs related to PHF1 Partial Recombinant Protein (H00005252-Q01).

Blogs on PHF1.

H3.1t - A testis-specific histone variant
Histones are nuclear proteins essential for the storage and organization of genomic DNA as chromatin. Chromatin consists of DNA wrapped tightly around histone oligomers to form nucleosomes. In addition to compacting the genome, histones also regula...  Read full blog post.

Customers Who Bought This Also Bought

PHF1 Antibody
NBP1-82613

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PHF1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF1