PGL2 Antibody - BSA Free

Western Blot: PGL2 Antibody [NBP3-10124] - Western blot analysis of PGL2 in Mouse SP2/0 Whole Cell lysates. Antibody dilution at 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PGL2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of Mouse PGL2 (NP_079609.2). Peptide sequence PSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARLLYESR
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SDHAF2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 19 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PGL2 Antibody - BSA Free

• C11orf79
• FLJ20487
• hSDH5
• paraganglioma or familial glomus tumors 2
• PGL2chromosome 11 open reading frame 79
• SDH5SDH assembly factor 2
• succinate dehydrogenase assembly factor 2, mitochondrial
• succinate dehydrogenase complex assembly factor 2
• Succinate dehydrogenase subunit 5, mitochondrial

Background

The SDHAF2 gene encodes a protein necessary for the flavination of the succinate dehydrogenase complex subunit SDHA (MIM 600857) and thus for SDH activity (Hao et al., 2009 (PubMed 19628817)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SDHAF2