Recombinant Human PFKFB4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PFKFB4 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 14 - 122 of Human PFKFB4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPARGKTYISKKLTRYLNWIGVPTREFNVGQYRRDVVKTYKSFEFFLPDNEEGLKIRKQCALAALRDVRRFLSEEG

Protein/Peptide Type
Partial Recombinant Protein
Gene
PFKFB4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PFKFB4 Protein

  • 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4,6-phosphofructo-2-kinase/fructose-2,6-biphosphatase-4,6PF-2-K/Fru-2,6-P2ase 4,6PF-2-K/Fru-2,6-P2ase testis-type isozyme
  • bifunctional enzyme with kinase and biphosphatase activities
  • PFK/FBPase 4

Background

PFKFB4 - 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005209-M08
Species: Hu
Applications: WB, ELISA, IP
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP2-01407
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005207-D01P
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NBP1-32452
Species: Hu, Mu, Rt
Applications: WB
NBP1-31806
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP1-84880
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PFKFB4 Partial Recombinant Protein (H00005210-Q01) (0)

There are no publications for PFKFB4 Partial Recombinant Protein (H00005210-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PFKFB4 Partial Recombinant Protein (H00005210-Q01) (0)

There are no reviews for PFKFB4 Partial Recombinant Protein (H00005210-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PFKFB4 Partial Recombinant Protein (H00005210-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PFKFB4 Products

Bioinformatics Tool for PFKFB4 Partial Recombinant Protein (H00005210-Q01)

Discover related pathways, diseases and genes to PFKFB4 Partial Recombinant Protein (H00005210-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PFKFB4 Partial Recombinant Protein (H00005210-Q01)

Discover more about diseases related to PFKFB4 Partial Recombinant Protein (H00005210-Q01).
 

Pathways for PFKFB4 Partial Recombinant Protein (H00005210-Q01)

View related products by pathway.

PTMs for PFKFB4 Partial Recombinant Protein (H00005210-Q01)

Learn more about PTMs related to PFKFB4 Partial Recombinant Protein (H00005210-Q01).

Blogs on PFKFB4

There are no specific blogs for PFKFB4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PFKFB4 Antibody
NBP1-32538

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PFKFB4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PFKFB4