Recombinant Human PFKFB4 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human PFKFB4 Protein [H00005210-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human PFKFB4 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 14-122 of Human PFKFB4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: KIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPARGKTYISKKLTRYLNWIGVPTREFNVGQYRRDVVKTYKSFEFFLPDNEEGLKIRKQCALAALRDVRRFLSEEG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PFKFB4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PFKFB4 GST (N-Term) Protein

  • 6PF-2-K/Fru-2,6-P2ase 4
  • 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4,6-phosphofructo-2-kinase/fructose-2,6-biphosphatase-4,6PF-2-K/Fru-2,6-P2ase 4,6PF-2-K/Fru-2,6-P2ase testis-type isozyme
  • bifunctional enzyme with kinase and biphosphatase activities
  • PFK/FBPase 4
  • PFKFB4

Background

PFKFB4 - 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005209-M08
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-01407
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-75578
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-45238
Species: Bv, Ca, Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-67503
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB110-39113
Species: Hu, Mu, Rb, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-88941
Species: Hu
Applications: IHC, IHC-P
H00005207-D01P
Species: Hu, Rt
Applications: ICC/IF, WB
NBP2-45626
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NLS1907
Species: Hu
Applications: ICC, IHC, IHC-P
NBP1-32452
Species: Hu, Mu, Rt
Applications: WB
NBP1-31806
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
233-FB/CF
Species: Hu
Applications: BA
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB100-122
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
NBP1-84880
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for PFKFB4 Partial Recombinant Protein (H00005210-Q01) (0)

There are no publications for PFKFB4 Partial Recombinant Protein (H00005210-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PFKFB4 Partial Recombinant Protein (H00005210-Q01) (0)

There are no reviews for PFKFB4 Partial Recombinant Protein (H00005210-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PFKFB4 Partial Recombinant Protein (H00005210-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PFKFB4 Products

Bioinformatics Tool for PFKFB4 Partial Recombinant Protein (H00005210-Q01)

Discover related pathways, diseases and genes to PFKFB4 Partial Recombinant Protein (H00005210-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PFKFB4 Partial Recombinant Protein (H00005210-Q01)

Discover more about diseases related to PFKFB4 Partial Recombinant Protein (H00005210-Q01).
 

Pathways for PFKFB4 Partial Recombinant Protein (H00005210-Q01)

View related products by pathway.

PTMs for PFKFB4 Partial Recombinant Protein (H00005210-Q01)

Learn more about PTMs related to PFKFB4 Partial Recombinant Protein (H00005210-Q01).

Blogs on PFKFB4

There are no specific blogs for PFKFB4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PFKFB4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PFKFB4