PEX11A Antibody - Azide and BSA Free

Western Blot: PEX11A Antibody [NBP2-94259] - Analysis of extracts of various cell lines, using PEX11A at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 60s.

Product Discontinued

PEX11A Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 110-180 of human PEX11A (NP_003838.1). LTSGINKEKWRTRAAHHYYYSLLLSLVRDLYEISLQMKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PEX11A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500-1:2000
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for PEX11A Antibody - Azide and BSA Free

• 28 kDa peroxisomal integral membrane protein
• hsPEX11p
• MGC119947
• MGC138534
• Peroxin-11A
• peroxisomal biogenesis factor 11 alpha
• Peroxisomal biogenesis factor 11Aperoxin-11A
• peroxisomal membrane protein 11A
• PEX11
• PEX11-ALPHA
• PMP28
• Protein PEX11 homolog alpha

Background

PEX11A may be involved in peroxisomal proliferation and may regulate peroxisomes division. May mediate binding of coatomer proteins to the peroxisomal membrane

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: PEX11A