PERQ2 Recombinant Protein Antigen

Images

 
There are currently no images for PERQ2 Recombinant Protein Antigen (NBP2-56704PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PERQ2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GIGYF2.

Source: E.coli

Amino Acid Sequence: QQYAQVLAQQQKAALSSQQQQQLALLLQQFQTLKMRISDQNIIPSVTRSVSVPDTGSIWELQPTASQPTVWEGGSVWDLPL

Protein/Peptide Type
Recombinant Protein Antigen
Gene
GIGYF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-56704. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PERQ2 Recombinant Protein Antigen

  • DKFZp686J17223
  • FLJ23368
  • GRB10 interacting GYF protein 2
  • GRB10-interacting GYF protein 2
  • GYF domain containing 2
  • GYF2
  • KIAA0642DKFZp686I15154
  • PARK11
  • Parkinson disease (autosomal recessive, early onset) 11
  • PERQ amino acid rich, with GYF domain 2
  • PERQ amino acid rich, with GYF domain 3
  • PERQ amino acid-rich with GYF domain-containing protein 2
  • PERQ2
  • PERQ3
  • TNRC15
  • trinucleotide repeat containing 15
  • Trinucleotide repeat-containing gene 15 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-81784
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-88153
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84658
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-89679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1458
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-92354
Species: Hu
Applications: IHC, IHC-P
MAB391
Species: Hu, Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-55757
Species: Mu
Applications: WB
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP2-56704PEP
Species: Hu
Applications: AC

Publications for PERQ2 Recombinant Protein Antigen (NBP2-56704PEP) (0)

There are no publications for PERQ2 Recombinant Protein Antigen (NBP2-56704PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PERQ2 Recombinant Protein Antigen (NBP2-56704PEP) (0)

There are no reviews for PERQ2 Recombinant Protein Antigen (NBP2-56704PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for PERQ2 Recombinant Protein Antigen (NBP2-56704PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array NBP2-56704PEP

Bioinformatics Tool for PERQ2 Recombinant Protein Antigen (NBP2-56704PEP)

Discover related pathways, diseases and genes to PERQ2 Recombinant Protein Antigen (NBP2-56704PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PERQ2 Recombinant Protein Antigen (NBP2-56704PEP)

Discover more about diseases related to PERQ2 Recombinant Protein Antigen (NBP2-56704PEP).
 

Pathways for PERQ2 Recombinant Protein Antigen (NBP2-56704PEP)

View related products by pathway.

PTMs for PERQ2 Recombinant Protein Antigen (NBP2-56704PEP)

Learn more about PTMs related to PERQ2 Recombinant Protein Antigen (NBP2-56704PEP).

Blogs on PERQ2

There are no specific blogs for PERQ2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PERQ2 Antibody
NBP2-12812

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PERQ2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GIGYF2