PER2 Antibody

Images

 
Immunohistochemistry-Paraffin: PER2 Antibody [NBP2-49316] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PER2 Antibody [NBP2-49316] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: PER2 Antibody [NBP2-49316] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: PER2 Antibody [NBP2-49316] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PER2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LSIFQSHCHYYLQERSKGQPSERTAPGLRNTSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQSSCPA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PER2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PER2 Recombinant Protein Antigen (NBP2-49316PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PER2 Antibody

  • Circadian clock protein PERIOD 2
  • FASPS
  • hPER2
  • KIAA0347period 2
  • period (Drosophila) homolog 2
  • period circadian protein 2
  • period circadian protein homolog 2
  • period homolog 2 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24589
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, WB
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2288
Species: Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
NBP1-86436
Species: Hu
Applications: IHC, IHC-P
NB100-126
Species: Hu, Mu
Applications: ChIP, WB
AF3764
Species: Hu, Mu
Applications: ICC, IHC, WB
664-LI/CF
Species: Hu
Applications: BA
NBP2-00749
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-83997
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-88027
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: IF, IHC, IHC-P, IP, PLA, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
AF6989
Species: Mu
Applications: IHC
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-31363
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00009572-M02
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, KD, WB

Publications for PER2 Antibody (NBP2-49316) (0)

There are no publications for PER2 Antibody (NBP2-49316).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PER2 Antibody (NBP2-49316) (0)

There are no reviews for PER2 Antibody (NBP2-49316). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PER2 Antibody (NBP2-49316) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PER2 Products

Array NBP2-49316

Bioinformatics Tool for PER2 Antibody (NBP2-49316)

Discover related pathways, diseases and genes to PER2 Antibody (NBP2-49316). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PER2 Antibody (NBP2-49316)

Discover more about diseases related to PER2 Antibody (NBP2-49316).
 

Pathways for PER2 Antibody (NBP2-49316)

View related products by pathway.

PTMs for PER2 Antibody (NBP2-49316)

Learn more about PTMs related to PER2 Antibody (NBP2-49316).
 

Research Areas for PER2 Antibody (NBP2-49316)

Find related products by research area.

Blogs on PER2

There are no specific blogs for PER2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PER2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PER2