Recombinant Human Peptide YY Protein

Images

 
SDS-Page: Recombinant Human Peptide YY Protein [H00005697-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Peptide YY Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 35431 of Human PYY full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PYY
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Peptide YY Protein

  • Peptide tyrosine tyrosine
  • Peptide YY
  • Peptide-YY
  • PYY
  • PYY1
  • PYY-I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP2-60645
Species: Hu
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-32424
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
MAB8864
Species: Hu
Applications: IHC
NBP2-75554
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NB110-59978
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00005697-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for Peptide YY Recombinant Protein (H00005697-P01) (0)

There are no publications for Peptide YY Recombinant Protein (H00005697-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Peptide YY Recombinant Protein (H00005697-P01) (0)

There are no reviews for Peptide YY Recombinant Protein (H00005697-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Peptide YY Recombinant Protein (H00005697-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Peptide YY Recombinant Protein (H00005697-P01)

Discover related pathways, diseases and genes to Peptide YY Recombinant Protein (H00005697-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Peptide YY Recombinant Protein (H00005697-P01)

Discover more about diseases related to Peptide YY Recombinant Protein (H00005697-P01).
 

Pathways for Peptide YY Recombinant Protein (H00005697-P01)

View related products by pathway.

PTMs for Peptide YY Recombinant Protein (H00005697-P01)

Learn more about PTMs related to Peptide YY Recombinant Protein (H00005697-P01).
 

Research Areas for Peptide YY Recombinant Protein (H00005697-P01)

Find related products by research area.

Blogs on Peptide YY

There are no specific blogs for Peptide YY, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Peptide YY Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PYY