Peptide YY Antibody

Images

 
Western Blot: Peptide YY Antibody [H00005697-D01P] - Analysis of PYY expression in transfected 293T cell line by PYY polyclonal antibody.Lane 1: PYY transfected lysate(11.10 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Peptide YY Antibody Summary

Immunogen
PYY (AAH41057.1, 1 a.a. - 97 a.a.) full-length human protein. MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW
Specificity
PYY - peptide YY,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PYY
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Peptide YY Antibody

  • Peptide tyrosine tyrosine
  • Peptide YY
  • Peptide-YY
  • PYY
  • PYY1
  • PYY-I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
MAB8200
Species: Hu, Mu
Applications: IHC
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
MAB8864
Species: Hu
Applications: IHC
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NB110-59978
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00005697-D01P
Species: Hu
Applications: WB

Publications for Peptide YY Antibody (H00005697-D01P) (0)

There are no publications for Peptide YY Antibody (H00005697-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Peptide YY Antibody (H00005697-D01P) (0)

There are no reviews for Peptide YY Antibody (H00005697-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Peptide YY Antibody (H00005697-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Peptide YY Products

Bioinformatics Tool for Peptide YY Antibody (H00005697-D01P)

Discover related pathways, diseases and genes to Peptide YY Antibody (H00005697-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Peptide YY Antibody (H00005697-D01P)

Discover more about diseases related to Peptide YY Antibody (H00005697-D01P).
 

Pathways for Peptide YY Antibody (H00005697-D01P)

View related products by pathway.

PTMs for Peptide YY Antibody (H00005697-D01P)

Learn more about PTMs related to Peptide YY Antibody (H00005697-D01P).
 

Research Areas for Peptide YY Antibody (H00005697-D01P)

Find related products by research area.

Blogs on Peptide YY

There are no specific blogs for Peptide YY, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Peptide YY Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PYY
Entrez
Uniprot