PEPP3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PEPP3 Antibody [NBP1-87889] - Staining of human cell line RT4 shows localization to cell junctions.
Immunohistochemistry-Paraffin: PEPP3 Antibody [NBP1-87889] - Staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PEPP3 Antibody [NBP1-87889] - Staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PEPP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SIHEVDISNLEAALRAEEPGGHAYETPREEIARLRKMELEPQHYDVDINKELSTPDKVLIPERYIDLEPDTPLSPEELKEKQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLEKHA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PEPP3 Recombinant Protein Antigen (NBP1-87889PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PEPP3 Antibody

  • KIAA0969MGC176733
  • PEPP-3
  • PEPP3Phosphoinositol 3-phosphate-binding protein 3
  • PH domain-containing family A member 6
  • phosphoinositol 3-phosphate-binding protein-3
  • pleckstrin homology domain containing, family A member 6
  • pleckstrin homology domain-containing family A member 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
AF6144
Species: Hu
Applications: WB, Simple Western
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-87173
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84686
Species: Hu
Applications: WB, IHC, IHC-P
H00084528-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
NBP1-45672
Species: Hu, Mu, Rt
Applications: WB
NBP2-47331
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76822
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-84612
Species: Hu
Applications: WB, IHC, IHC-P
H00009261-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-59794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-74351
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81283
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PEPP3 Antibody (NBP1-87889) (0)

There are no publications for PEPP3 Antibody (NBP1-87889).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEPP3 Antibody (NBP1-87889) (0)

There are no reviews for PEPP3 Antibody (NBP1-87889). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PEPP3 Antibody (NBP1-87889) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PEPP3 Products

Bioinformatics Tool for PEPP3 Antibody (NBP1-87889)

Discover related pathways, diseases and genes to PEPP3 Antibody (NBP1-87889). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEPP3 Antibody (NBP1-87889)

Discover more about diseases related to PEPP3 Antibody (NBP1-87889).
 

Pathways for PEPP3 Antibody (NBP1-87889)

View related products by pathway.

PTMs for PEPP3 Antibody (NBP1-87889)

Learn more about PTMs related to PEPP3 Antibody (NBP1-87889).

Blogs on PEPP3

There are no specific blogs for PEPP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEPP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEKHA6